PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g090670.1
Common NameMTR_1g090670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 296aa    MW: 32789.3 Da    PI: 6.8839
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g090670.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1085.2e-344498155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWt++LH+rFv+av+qLGG+ kAtPk+i+++m+vkgLtl+h+kSHLQkYRl
  Medtr1g090670.1 44 KPRLRWTTDLHQRFVDAVTQLGGPTKATPKAIMRTMNVKGLTLYHLKSHLQKYRL 98
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.92541101IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-334199IPR009057Homeodomain-like
SuperFamilySSF466891.4E-164499IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-244499IPR006447Myb domain, plants
PfamPF002493.8E-84697IPR001005SANT/Myb domain
PfamPF143793.6E-13139184IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MFSRLIRPHD HEGSVVVVQE DSNHHLHTHL AASDPCLVLT SDPKPRLRWT TDLHQRFVDA  60
VTQLGGPTKA TPKAIMRTMN VKGLTLYHLK SHLQKYRLGK QAGKDFDEGC KDGSYLLESP  120
GTENSSPKLP ASDANEGHEV KEALRAQMEV QSKLHLLVEA EKHLQIRQDA ERRYMAMLER  180
ACKMLADQFI GDTTIDTDIQ KFQELPSTEL GGNGMHISEV PYILQPQGAN CSTESCLTSL  240
ESLRGLTLEG SPSGTKRMLG LDSMVSPLIW SETNMRTQGI HLAQVNPQGI ARYGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-1844100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1844100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1844100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1844100157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.16690.0leaf| root
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g090670.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0951071e-146BT095107.1 Soybean clone JCVI-FLGm-19M17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013469265.10.0protein PHR1-LIKE 3
SwissprotQ94A577e-64PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A072VPG60.0A0A072VPG6_MEDTR; Myb-like transcription factor family protein
STRINGXP_004496120.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.14e-65G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]