PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g088860.1
Common NameMTR_1g088860, NF-YB6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NF-YB
Protein Properties Length: 195aa    MW: 22243.4 Da    PI: 5.7934
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g088860.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB171.96.9e-5435130297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      +eqdr+lPianv+rimk++lP nakiskdaket+qecvsef+sfvt+easdkc++ekrkt+ngdd++wal+tlGf+dy+eplk yl kyrel++
  Medtr1g088860.1  35 KEQDRLLPIANVGRIMKQILPPNAKISKDAKETMQECVSEFVSFVTGEASDKCHKEKRKTVNGDDVCWALGTLGFDDYAEPLKRYLYKYRELDA 128
                      89******************************************************************************************98 PP

            NF-YB  96 ek 97 
                      e+
  Medtr1g088860.1 129 ER 130
                      86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.0E-5428156IPR009072Histone-fold
SuperFamilySSF471136.44E-4137160IPR009072Histone-fold
PfamPF008083.2E-2740104IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.6E-196886No hitNo description
PRINTSPR006153.6E-1987105No hitNo description
PRINTSPR006153.6E-19106124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MGDNNKGKQV SDREVFKYNT NFTSHEQEQD HEVIKEQDRL LPIANVGRIM KQILPPNAKI  60
SKDAKETMQE CVSEFVSFVT GEASDKCHKE KRKTVNGDDV CWALGTLGFD DYAEPLKRYL  120
YKYRELDAER GNQNNKGNNN INININNNNS DEIENNINET YYYDDGKSQT PRKVNVASSS  180
MFNNRNSGPQ SRGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A2e-4431125397NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.257340.0root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}.
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g088860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182790.0JQ918279.1 Medicago truncatula nuclear transcription factor Y subunit B6 (NF-YB6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013469195.11e-143nuclear transcription factor Y subunit B-4
SwissprotO822482e-59NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLI3TAW41e-142I3TAW4_MEDTR; Nuclear transcription factor Y protein
STRINGGLYMA02G17310.11e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.12e-59nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]