PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g081580.1
Common NameMTR_1g081580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GeBP
Protein Properties Length: 388aa    MW: 42961 Da    PI: 4.9138
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g081580.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573119.22.2e-3795191197
           DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskk 94 
                      klfqr+w+eeDei++LqG++d++a++++s+++d+  fy+ +k++i+++++ksqlv+K+rrLKkK+++  +k +sgk++ f+++hdq +fe+s+k
  Medtr1g081580.1  95 KLFQRIWTEEDEITILQGFLDYNANRESSYHNDTGSFYDHMKGKIQLDFTKSQLVDKLRRLKKKYRTALQKFDSGKDFGFKSTHDQAAFEISHK 188
                      579******************************************************************************************* PP

           DUF573  95 iWg 97 
                      iW+
  Medtr1g081580.1 189 IWN 191
                      **7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.1E-3397191IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MAFSRNGVVI PTHDEHADIE EEDDDDLEEE DNYFVQPNTD HHYQTEQSPS TFATAAVPTS  60
VILALPHASA SATTIDGSPE PKREPMEEKT SDSRKLFQRI WTEEDEITIL QGFLDYNANR  120
ESSYHNDTGS FYDHMKGKIQ LDFTKSQLVD KLRRLKKKYR TALQKFDSGK DFGFKSTHDQ  180
AAFEISHKIW NINGNSTPIG VPVEEDDEII PNPNPNSSHL AEKKAVQSRK RSRAAEEERH  240
ELNDSKDNHQ NNSGNTNSSN VDENREKSNG NHVHNVPGLI EETVKSCLTP VLKELSNATM  300
SGSPFGFGGR GFGAGGFSMN TVPLGFLNLG SGEKAVDDKW RKQQILELEV YSKRLELVQD  360
EVKAAIEELR SNAGAGGAGG SGNNTNQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g081580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003591032.20.0probable transcription factor At3g04930
TrEMBLG7I7E70.0G7I7E7_MEDTR; Putative transcription factor GeBP family
STRINGAES612830.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32553365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28040.15e-60DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]