PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g080330.2
Common NameMTR_1g080330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 287aa    MW: 32140.8 Da    PI: 4.6264
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g080330.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1101.2e-34175229155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr+rWtpeLHe+Fveav+qLGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  Medtr1g080330.2 175 KPRMRWTPELHEAFVEAVNQLGGSEKATPKGVLNLMKVEGLTIYHVKSHLQKYRT 229
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.5E-33172231IPR009057Homeodomain-like
PROSITE profilePS5129412.597172232IPR017930Myb domain
SuperFamilySSF466893.94E-18173229IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-25175229IPR006447Myb domain, plants
PfamPF002494.4E-10177228IPR001005SANT/Myb domain
PfamPF143799.9E-10262282IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MSSSIPSSSM QAASINSNIR SVGHMFSTPS EQPDNVHFSS ASEIHSMTFP QESDVMSWGT  60
DPFEDILQFH DNVPTQNDHV EYNGSEVLGG NAKTTDFKEW VDQLMSVDDD SIQPNWNELL  120
GDNNMAEPKS QDAQMSPSLL MQETQVSQQQ YIPSLPSKEV NDLPNSSVST TSQSKPRMRW  180
TPELHEAFVE AVNQLGGSEK ATPKGVLNLM KVEGLTIYHV KSHLQKYRTA RYKPESSEGI  240
PEKKLTSIDE MPSIDLKTPK GITEALRLQM ELQKRLHEQL EVYLSW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-32175233260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-32175233260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-32175233260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-32175233260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-32175233260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-32175233260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-32175233260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-32175233260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.126970.0leaf| root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoots and roots. {ECO:0000269|PubMed:20838596}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as central integrator of phosphate starvation responses (PubMed:20838596). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). {ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:23788639}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g080330.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated by Pi starvation. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1354610.0AC135461.11 Medicago truncatula clone mth2-34f24, complete sequence.
GenBankAC1377010.0AC137701.27 Medicago truncatula clone mth2-35h1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003590977.10.0protein PHR1-LIKE 1
SwissprotQ8GUN52e-68PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A072VLW70.0A0A072VLW7_MEDTR; Myb-like transcription factor family protein
STRINGAES612280.0(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.36e-71G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  5. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]