PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g077600.2
Common NameMTR_1g077600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 292aa    MW: 32289 Da    PI: 7.4403
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g077600.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.36.9e-383999262
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     k++a++cprC+s ntkfCyynnysl+qPryfCk+CrryWt+GG++rn+PvGgg+rkn+k++
  Medtr1g077600.2 39 KQEAINCPRCNSINTKFCYYNNYSLTQPRYFCKTCRRYWTQGGSIRNIPVGGGSRKNNKNR 99
                     7899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-233187IPR003851Zinc finger, Dof-type
PfamPF027011.2E-324197IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.4074397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MDTTQWPQEI MVKPLIEGNI IATNTCEKPM LERKPKQQKQ EAINCPRCNS INTKFCYYNN  60
YSLTQPRYFC KTCRRYWTQG GSIRNIPVGG GSRKNNKNRS SSSFVSNPSP STKNILDENQ  120
NHKIHHEEGQ DLNLGFPHIS DLVQQNNNTS SSTSSALELL TSGFSSSSRG LHSFMPAQVQ  180
GCGFPLQDFK QVPMNFCLDG IGGSGYASLD HGVQETISEG RVLFPFEDLK HVSSTNNPTI  240
LDLDQNNNKE DQQGYSTGIW TGMLGGEGGG SWFWGVSVAE KYMSALKQVS P*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.263100.0flower
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at preprocambial stages first in wide domains, and later confined to sites of vein development. {ECO:0000269|PubMed:20563990}.
UniprotTISSUE SPECIFICITY: Accumulates in the stele. {ECO:0000269|PubMed:20563990}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g077600.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0878521e-54AB087852.1 Pisum sativum PsDof7 mRNA for DNA binding with one finger 7 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013468849.10.0dof zinc finger protein DOF4.6
SwissprotQ8LAP86e-55DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A072VXW20.0A0A072VXW2_MEDTR; Dof-type zinc finger DNA-binding family protein
STRINGXP_004495498.15e-96(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-38Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]