PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g075570.1
Common NameMTR_1g075570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 165aa    MW: 18367.2 Da    PI: 8.9918
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g075570.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF59.54.2e-19243445
                     -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     +n+sn qvtfsk  ng++KKA+EL++LC+a +a+i+fs++ k
  Medtr1g075570.1  2 SNESNLQVTFSKHCNGLFKKASELCTLCGAYIALIVFSPSEK 43
                     79*************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.5E-13150IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.371144IPR002100Transcription factor, MADS-box
PfamPF003197.6E-20244IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.29E-16248IPR002100Transcription factor, MADS-box
CDDcd001208.07E-19243No hitNo description
PRINTSPR004042.9E-51328IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-52849IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MSNESNLQVT FSKHCNGLFK KASELCTLCG AYIALIVFSP SEKIVISQVP PQNSGPMQFI  60
EANRSAKLRE LNAMLTQIND ALDIGKKREN ELSDLRKKNE TQFWWACPIE GMDRVQLQLL  120
KKALLDLKKR IGQHANMVVS QGTPTQTFPF FVGNGSSSNM PIEH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1444810.0AC144481.8 Medicago truncatula clone mth2-35e10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003590820.21e-121MADS-box transcription factor family protein
TrEMBLG7I4T51e-120G7I4T5_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA10G40080.12e-45(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-28AGAMOUS-like 62
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]