PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g063870.1
Common NameMTR_1g063870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family TCP
Protein Properties Length: 206aa    MW: 21958.5 Da    PI: 7.6424
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g063870.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP111.71e-3444118377
              TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaes 77 
                      ++ ++++++hTkv+gR+RRvR++ +caar+F+L++eLG+ +d++tieWLl+ a+p+i+++tgt++ +a  ++++s
  Medtr1g063870.1  44 PASRSTKDRHTKVNGRGRRVRMPPLCAARIFQLTRELGHRSDGETIEWLLRHAEPSIIAATGTGTVPAGPVSTSS 118
                      56789**********************************************************777773332222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.4E-3048166IPR005333Transcription factor, TCP
PROSITE profilePS5136927.0449103IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MSSSEVVIHT FSQTQSETKP STAVTTTVAT TSSDPNTKLT VRRPASRSTK DRHTKVNGRG  60
RRVRMPPLCA ARIFQLTREL GHRSDGETIE WLLRHAEPSI IAATGTGTVP AGPVSTSSPF  120
TSSSLPSVSC HVQPATTVGP GGGGIFGMAL PMQPPSCRLD LSQPAGMDYG TASRYHHMPF  180
TTLLLQPTTT GEENQQEDEE SLNEQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g063870.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1537250.0AC153725.3 Medicago truncatula clone mth2-78c5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003590456.11e-149transcription factor TCP11
SwissprotQ9SJK75e-39TCP11_ARATH; Transcription factor TCP11
TrEMBLG7IA901e-147G7IA90_MEDTR; Putative transcription factor TCP family
STRINGAES607071e-148(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58100.15e-36TCP family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]