PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g056810.1
Common NameMTR_1g056810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 289aa    MW: 32531.2 Da    PI: 6.4994
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g056810.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.11.4e-361266660
           zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                      +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rkn++
  Medtr1g056810.1 12 PNCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRR 66
                     58***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.3E-311266IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6771266IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101450IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-211457IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MESEWKANQI SPNCPRCGSS NTKFCYYNNY SLTQPRYFCK GCRRYWTKGG SLRNVPVGGG  60
CRKNRRGNNK TLVRHRSFDS LTFKNSPNSL TTLDNNHSYD PILRTNISSS SSSLVNDRPN  120
IDLALVYANF LNQKPDSHIP DQMRKTNFDP CLENSRLSNV EGGTSSLNLS ELELGFKGCL  180
NLNPEQLPST TVTNFSEFNS MQTLQKDRID HCSNIHDDGL NVNFELPPLP GEEDSPSHDH  240
VLWSNSEMMI NLPFQVTQPP PPFLGPDQIH DADLLIGNWS PFDFPRDA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g056810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150412e-50AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013467842.10.0dof zinc finger protein DOF3.5
TrEMBLA0A072VIR10.0A0A072VIR1_MEDTR; Dof domain zinc finger protein
STRINGGLYMA10G10142.11e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.13e-40Dof family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]