PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g053830.1
Common NameMTR_1g053830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 100aa    MW: 10994.6 Da    PI: 9.9753
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g053830.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.53.1e-281972255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     +r+ Wtp+LH++Fve v++LGG+ekA Pk+il lm+++gLt+ +vkSHL kYR+
  Medtr1g053830.1 19 TRITWTPDLHDKFVESVNRLGGAEKALPKAILMLMQLDGLTIFQVKSHLKKYRM 72
                     79***************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-241673IPR009057Homeodomain-like
SuperFamilySSF466893.58E-151772IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-211873IPR006447Myb domain, plants
PfamPF002491.9E-72271IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MSTTSGNPIT NASSVSSNTR ITWTPDLHDK FVESVNRLGG AEKALPKAIL MLMQLDGLTI  60
FQVKSHLKKY RMAKYMAEPA QGESEKRTNV ENMHLDAKS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-231775159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-231775159Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A8e-232075358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-232075358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-232075358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-232075358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-231775159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-231775159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-231775159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-231775159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-231775159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-231775159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g053830.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013467655.23e-69myb family transcription factor PHL5
SwissprotQ0WVU35e-29PHL5_ARATH; Myb family transcription factor PHL5
TrEMBLA0A072VIP16e-68A0A072VIP1_MEDTR; MYB-like transcription factor family protein
STRINGGLYMA09G17404.19e-43(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1787557
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.25e-32G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]