PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g047550.1
Common NameMTR_1g047550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 180aa    MW: 20367.3 Da    PI: 9.6267
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g047550.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.27.8e-221257449
                     -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     ++   rqvtfskRr+g++KKA+ELS+LC+aeva+++fs+ ++ y +
  Medtr1g047550.1 12 KDPNTRQVTFSKRRTGLFKKANELSILCGAEVAIVVFSPGDRPYSF 57
                     56678*********************************98776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-33160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.52161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.54E-27171IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-19323IPR002100Transcription factor, MADS-box
PfamPF003194.9E-251257IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MGRRKIEIEI VKDPNTRQVT FSKRRTGLFK KANELSILCG AEVAIVVFSP GDRPYSFGHP  60
GVDVVAAKYL QQEADASDSQ GNPSSNAPKM EKLNLKLAEI LTQIREGERQ AENHDEILKE  120
NDVTKLSELK ELRDSYKELQ DWVKLRLSDI EISEYMMLLA QEPVVGIKAK SAKRKRRRN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-17169169Myocyte-specific enhancer factor 2B
1tqe_R2e-17169169Myocyte-specific enhancer factor 2B
1tqe_Q2e-17169169Myocyte-specific enhancer factor 2B
1tqe_P2e-17169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172177KRKRRR
2173177RKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT9631050.0CT963105.1 Medicago truncatula chromosome 5 clone mte1-71h1, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013467229.11e-130MADS-box transcription factor family protein
TrEMBLA0A072VIJ31e-130A0A072VIJ3_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA05G35820.13e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24242979
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-39AGAMOUS-like 29
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]