PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g046680.2
Common NameMTR_1g046680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GATA
Protein Properties Length: 245aa    MW: 26930.2 Da    PI: 7.0873
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g046680.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA62.74.2e-20174208135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++Cg+ +Tp+WR gp+g+ktLCnaCG++y++ +l
  Medtr1g046680.2 174 CHHCGVDDTPQWRAGPNGPKTLCNACGVRYKSGRL 208
                      *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.8E-17168218IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.295168204IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.08E-16170231No hitNo description
Gene3DG3DSA:3.30.50.102.7E-15172206IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.56E-15173221No hitNo description
PfamPF003204.4E-18174208IPR000679Zinc finger, GATA-type
PROSITE patternPS003440174199IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MEALGSVDDL LDFSSDIGED DDDDKPKKAF PSLKPECSDP PSLNPLALDD PINSLSEEVA  60
EEELEWLSNK DAFPAVETFV DLSCIQPDLL KHQMTSPMLE NSTSSSNSNN SSNSITLLSG  120
YNHMKFPVRA RSKSRSKPRL GLADASNLQF PWKQPSTKTS KEKVKQTPTI GRKCHHCGVD  180
DTPQWRAGPN GPKTLCNACG VRYKSGRLVP EYRPANSPTF RSDVHSNSHR KVVEMRKQKG  240
MGTG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.117990.0flower| leaf| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013467175.10.0GATA type zinc finger transcription factor family protein
TrEMBLA0A072VHW70.0A0A072VHW7_MEDTR; GATA type zinc finger transcription factor family protein
STRINGGLYMA10G25480.11e-106(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.14e-41GATA transcription factor 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]