PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g039040.1
Common NameMTR_1g039040, NF-YB10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NF-YB
Protein Properties Length: 191aa    MW: 21648 Da    PI: 5.8644
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g039040.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1702.8e-53599296
            NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
                     reqd+++Pianv+rim+++lP++akis+daket+qecvse+isf+tsea+d+cqre+rkt++++d+lwa+++lGf+dyv+pl+ yl++yre ege
  Medtr1g039040.1  5 REQDQYMPIANVIRIMRRILPSHAKISDDAKETIQECVSEYISFITSEANDRCQREQRKTVTAEDILWAMGKLGFDDYVHPLTFYLQRYRESEGE 99
                     89******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.8E-483105IPR009072Histone-fold
SuperFamilySSF471135.28E-377106IPR009072Histone-fold
PfamPF008085.0E-261074IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.1E-163856No hitNo description
PROSITE patternPS0068504157IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006158.1E-165775No hitNo description
PRINTSPR006158.1E-167694No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MAGIREQDQY MPIANVIRIM RRILPSHAKI SDDAKETIQE CVSEYISFIT SEANDRCQRE  60
QRKTVTAEDI LWAMGKLGFD DYVHPLTFYL QRYRESEGEP ASVRRTSSLA LPPSFPLMQQ  120
HSSSFSSMPL PLINNNNHNS NGYGHGYGFD FDQGFYRDGG DDAAPSSASF VPNFDCNFLH  180
LKRDNHNNNM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A2e-56495697NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed primarily during seed development. {ECO:0000269|PubMed:12509518}.
UniprotTISSUE SPECIFICITY: Expressed in roots, flowers and developing siliques. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}.
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g039040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1517090.0AC151709.9 Medicago truncatula clone mth2-31g22, complete sequence.
GenBankJQ9182830.0JQ918283.1 Medicago truncatula nuclear trancription factor Y subunit B10 (NF-YB10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003589766.11e-143nuclear transcription factor Y subunit B-4
SwissprotQ84W663e-57NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLG7ICG41e-141G7ICG4_MEDTR; Ccaat-box-binding factor HAP3-like protein
STRINGAES600171e-142(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-59nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Jia H,McCarty DR,Suzuki M
    Distinct roles of LAFL network genes in promoting the embryonic seedling fate in the absence of VAL repression.
    Plant Physiol., 2013. 163(3): p. 1293-305
    [PMID:24043445]
  3. Kim HU, et al.
    Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues.
    FEBS Open Bio, 2013. 4: p. 25-32
    [PMID:24363987]
  4. Gnesutta N,Saad D,Chaves-Sanjuan A,Mantovani R,Nardini M
    Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants.
    Mol Plant, 2017. 10(4): p. 645-648
    [PMID:27871811]
  5. Li D, et al.
    MYB89 Transcription Factor Represses Seed Oil Accumulation.
    Plant Physiol., 2017. 173(2): p. 1211-1225
    [PMID:27932421]
  6. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  7. Han JD, et al.
    Evolutionary Analysis of the LAFL Genes Involved in the Land Plant Seed Maturation Program.
    Front Plant Sci, 2017. 8: p. 439
    [PMID:28421087]