PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g029100.1
Common NameMTR_1g029100, NF-YB19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NF-YB
Protein Properties Length: 91aa    MW: 10363 Da    PI: 4.4206
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g029100.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB79.25.5e-25587688
            NF-YB  6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88
                       +Pi  v+r+m+ vlP ++ i++dake++q cvs+f+ +vtse+ ++++ e++  +++ddllw++  lGfe++v +l + lk
  Medtr1g029100.1  5 VRMPINHVTRVMQSVLPPDTIITDDAKELMQLCVSKFMDMVTSESFQQANVEHQMIVSADDLLWTMNRLGFEEFVRSLGKDLK 87
                     579************************************************************************99987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.4E-23389IPR009072Histone-fold
SuperFamilySSF471131.68E-19386IPR009072Histone-fold
PfamPF008082.2E-12669IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MGEEVRMPIN HVTRVMQSVL PPDTIITDDA KELMQLCVSK FMDMVTSESF QQANVEHQMI  60
VSADDLLWTM NRLGFEEFVR SLGKDLKQCQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A2e-187821388NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g029100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182921e-151JQ918292.1 Medicago truncatula nuclear transcription factor Y subunit B19 (NF-YB19) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004498435.17e-25nuclear transcription factor Y subunit B-3-like
TrEMBLI3TAX72e-60I3TAX7_MEDTR; Nuclear transcription factor Y protein
STRINGXP_004498435.13e-24(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.31e-21nuclear factor Y, subunit B1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]