PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g029070.1
Common NameMTR_1g029070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NF-YB
Protein Properties Length: 173aa    MW: 18748.9 Da    PI: 5.0124
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g029070.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB114.74.7e-3651144295
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      ++++  lPi n++rim+++lP  akis+dak t+q cvs+f++ +t+ea +kc++e rk i+g+d++ a++ lGfedyv pl++ l++yr+ e+
  Medtr1g029070.1  51 KNEELCLPIRNLTRIMRRALPLYAKISQDAKATTQLCVSDFMGIITTEAVEKCNEESRKIISGEDIIRAMGRLGFEDYVGPLSLLLQNYRNHEA 144
                      677889************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-3348145IPR009072Histone-fold
SuperFamilySSF471137.51E-2653146IPR009072Histone-fold
PfamPF008081.9E-1657120IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.4E-684102No hitNo description
PRINTSPR006152.4E-6103121No hitNo description
PRINTSPR006152.4E-6122140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MERGSPSSNN NRSAHSSSVL LQAGSPSQNN ESPRTENIDV EIEKQDLPPT KNEELCLPIR  60
NLTRIMRRAL PLYAKISQDA KATTQLCVSD FMGIITTEAV EKCNEESRKI ISGEDIIRAM  120
GRLGFEDYVG PLSLLLQNYR NHEAQFSGMS TACGFNMDGS GTGGSSSGNG QY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A4e-2950140696NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g029070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013466407.11e-125transcriptional activator hap3
TrEMBLA0A072VGA71e-124A0A072VGA7_MEDTR; Nuclear transcription factor Y protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2117834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.16e-33nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]