PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g017090.1
Common NameMTR_1g017090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family HD-ZIP
Protein Properties Length: 289aa    MW: 32839.8 Da    PI: 7.7197
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g017090.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox611.8e-19129183256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ ++tkeq e+Lee F+++++++ ++++ LA+kl+L+ rqV vWFqNrRa+ k
  Medtr1g017090.1 129 RKKLRLTKEQSEVLEENFREHSTLNPKQKQALANKLNLQARQVEVWFQNRRARTK 183
                      78889************************************************98 PP

2HD-ZIP_I/II121.34.8e-39129217189
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                      +kk+rl+keq+++LEe+F+e+++L+p++K++la++L+lq+rqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een++L+ke +eL++
  Medtr1g017090.1 129 RKKLRLTKEQSEVLEENFREHSTLNPKQKQALANKLNLQARQVEVWFQNRRARTKLKQTESDCEVLKKCCESLTEENKKLQKELQELKS 217
                      69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.151125185IPR001356Homeobox domain
SuperFamilySSF466898.98E-18126193IPR009057Homeodomain-like
SMARTSM003899.6E-16127189IPR001356Homeobox domain
CDDcd000862.60E-15128186No hitNo description
PfamPF000466.1E-17129183IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.9E-17129183IPR009057Homeodomain-like
PROSITE patternPS000270160183IPR017970Homeobox, conserved site
SMARTSM003401.5E-16185228IPR003106Leucine zipper, homeobox-associated
PfamPF021834.7E-10185218IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MNVDDTSNTW FQLDLDLGLA LHDHFDDHRK RESKKKRVEN PSKCIKAYQM LTLGPSKEES  60
EENTKIQHST SKTESCDQNL PTQFTSPSIE SSFSNSTSIK KESGEEFEVE IEKVPITRIG  120
NFDKDCNPRK KLRLTKEQSE VLEENFREHS TLNPKQKQAL ANKLNLQARQ VEVWFQNRRA  180
RTKLKQTESD CEVLKKCCES LTEENKKLQK ELQELKSMQT VAAASFYMKI PAATLTICPS  240
CETICGGNNN GSLPSTTLLI GSKTHHHFHK NNKNDDNYQF PHSSSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1177185RRARTKLKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g017090.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013465933.10.0homeobox-leucine zipper protein HOX15
SwissprotA2XE761e-57HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL41e-57HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLA0A072VD790.0A0A072VD79_MEDTR; Homeobox associated leucine zipper protein
STRINGXP_004498976.11e-108(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-44HD-ZIP family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]