PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g013180.1
Common NameMTR_1g013180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARR-B
Protein Properties Length: 682aa    MW: 76775.5 Da    PI: 6.4093
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g013180.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.54.6e-26342395155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++W+ +LH++F+ av+qL G ekA+Pk+il+lm+ + Lt+e+v+SHLQkYRl
  Medtr1g013180.1 342 KPRVVWSADLHRKFLAAVKQL-GFEKAVPKKILDLMDDETLTRENVASHLQKYRL 395
                      79*******************.9*******************************8 PP

2Response_reg761.4e-251622671106
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+++ +++l+++l++ +y +v++a+++  al+ll+e++  +Dl++  + mp+mdG++ll+     e++lp+i+++a+++++++ + ++ 
  Medtr1g013180.1 162 VLAVDDDRTCLKILERLLQRCQY-HVTTAQSALTALNLLRENKsnFDLVISNVHMPDMDGFKLLELVGL-EMDLPVIMFSANDDPKMVMKGIDH 253
                      799********************.***************888888*******************87754.558********************* PP

                      TESEEEESS--HHH CS
     Response_reg  93 GakdflsKpfdpee 106
                      Ga d+l Kp+  +e
  Medtr1g013180.1 254 GACDYLLKPVTLKE 267
                      *********98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF134569.7E-790152No hitNo description
SuperFamilySSF521721.71E-34159283IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23006.1E-41159314No hitNo description
SMARTSM004481.3E-30160272IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.459161276IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-22162268IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.05E-25163275No hitNo description
Gene3DG3DSA:1.10.10.601.2E-27339399IPR009057Homeodomain-like
PROSITE profilePS5129410.381339398IPR017930Myb domain
SuperFamilySSF466892.51E-18340399IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-23342395IPR006447Myb domain, plants
PfamPF002495.2E-7344394IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MSSGSFSSIM FSILSALEVD TRARFVAILL SIWRARNGCL WEQNSVNAHA SCVLTMDIIR  60
DCMWCHRLND DAQSDTSVWS KPQTDWIKCN VDCALFEAEG KFGVGICFRD SLGHLIQANS  120
MVFPSFTNAA ECEATAIQQA LQIALELGLN RMNDQFPIGM RVLAVDDDRT CLKILERLLQ  180
RCQYHVTTAQ SALTALNLLR ENKSNFDLVI SNVHMPDMDG FKLLELVGLE MDLPVIMFSA  240
NDDPKMVMKG IDHGACDYLL KPVTLKEVQM IWQHVVRKKK TNKRSNRDAP NSDCGNGIDS  300
ARTGNFDQNE KPSRKRKEKN EDEDEDEDED DRDNDDSTAQ KKPRVVWSAD LHRKFLAAVK  360
QLGFEKAVPK KILDLMDDET LTRENVASHL QKYRLYLKKQ ANMAEVLGND SDKSYSRMGY  420
ISGVGAHVQP LNDPRQFHNN NSAFRSFPSS GMSTRLNTPS SSVNMHGFPA HNLNNSTGDH  480
LRFQSAIARS NLNDVQRMPF SSVDSQHSQF SHPLLEKRRC NDIWSSPMQQ LPETNSYLPK  540
EGFVHAAAMP PTYNMNSQGI IFNSSNNVPF QGWDNNHNNH DGSYHPSHVV GNSVGPSMIH  600
VLNAIEPEGN LDNNYCDRIA ELHEVPSLKP HEVYMMNNQM KAGNSHMSNE LDSLEDVMRV  660
MIKPKQLYAN FSGGTSMPRQ D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-23338399162ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1313318RKRKEK
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g013180.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024633364.10.0two-component response regulator ARR10
TrEMBLA0A072VE880.0A0A072VE88_MEDTR; Two-component response regulator
STRINGXP_004498785.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-104response regulator 12
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]