PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g013170.1
Common NameMTR_1g013170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARR-B
Protein Properties Length: 498aa    MW: 55771.2 Da    PI: 6.8309
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g013170.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.99.7e-28191244155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr +W+ +LH++Fv av+qL G +kA+Pk+ilelm+v+ Lt+e+v+SHLQkYRl
  Medtr1g013170.1 191 KPRTVWSADLHRKFVVAVNQL-GVDKAVPKKILELMNVENLTREKVASHLQKYRL 244
                      79*******************.********************************8 PP

2Response_reg75.61.9e-25111161106
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+++ +++l+++l++ +y +v++a+++  al+ll+e++  +Dl++  + mp+mdG++ll+     e++lp+i+++a+++++++ + ++ 
  Medtr1g013170.1  11 VLAVDDDRTCLKILEKLLQRCQY-HVTTAQNAITALNLLRENKsnFDLVISNVHMPDMDGFKLLELVGL-EMDLPVIMFSANDDPKMVMKGIEH 102
                      799********************.***************888888*******************87754.558********************* PP

                      TESEEEESS--HHH CS
     Response_reg  93 GakdflsKpfdpee 106
                      Ga d+l Kp+  +e
  Medtr1g013170.1 103 GACDYLLKPVRLKE 116
                      *********98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.2E-1481491IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.6E-418163No hitNo description
SuperFamilySSF521729.96E-358132IPR011006CheY-like superfamily
SMARTSM004483.1E-309121IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.58310125IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.8E-2311117IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.74E-2612125No hitNo description
PROSITE profilePS5129411.028188247IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-29188249IPR009057Homeodomain-like
SuperFamilySSF466891.16E-19189248IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-24191244IPR006447Myb domain, plants
PfamPF002494.6E-7193243IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MNDQFPIGMR VLAVDDDRTC LKILEKLLQR CQYHVTTAQN AITALNLLRE NKSNFDLVIS  60
NVHMPDMDGF KLLELVGLEM DLPVIMFSAN DDPKMVMKGI EHGACDYLLK PVRLKEVQII  120
WQHVIRKKKT SKRSNHDAPN SDSGNGKDSA GTGNSDKNER ASRKRKDKNE DDSEEENEDD  180
YDNDDQTAQK KPRTVWSADL HRKFVVAVNQ LGVDKAVPKK ILELMNVENL TREKVASHLQ  240
KYRLYLKRIS CAEDKQDHMA AALASSSDAS YLRSGVGGHL HTLNGSTQFH NHYNPFRSFP  300
SGGGMISSFN TPNNVNMHGL PSSGTLQPIQ THNLNNSTDD QLKFQSALTR GNPNDVQRDI  360
SISPIQNMTN NLPNFSFTNN PLMLEGNPQE KQIGEGYKNL ASQNSQYFSL LENRRCNRIW  420
SSTMQLPGTS SYLPRESFNH AAMPHLSFQG WDNNNNHDGS HHSSNVIGNS IGSSMIPGMN  480
VVEQEGNLDY NYGDSVQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-23187250164ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162167RKRKDK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g013170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024633361.10.0two-component response regulator ARR1
SwissprotA2X1N21e-123ORR24_ORYSI; Two-component response regulator ORR24
SwissprotQ6H8051e-123ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLA0A072VP360.0A0A072VP36_MEDTR; Two-component response regulator
STRINGXP_004498785.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-109response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]