PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g013160.1
Common NameMTR_1g013160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARR-B
Protein Properties Length: 160aa    MW: 17844 Da    PI: 5.6888
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g013160.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like27.75.9e-09125148124
          G2-like   1 kprlrWtpeLHerFveaveqLGGs 24 
                      kpr +W+ +LH +Fv av+qLG  
  Medtr1g013160.1 125 KPRTVWSADLHGKFVAAVNQLGVD 148
                      79*******************744 PP

2Response_reg28.95.9e-1115056106
                      SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHH CS
     Response_reg  56 mdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpee 106
                      mdG++ll+     e++lp+i+++a+++++++ + ++ Ga d+l+Kp+  +e
  Medtr1g013160.1   1 MDGFKLLELVGL-EMDLPVIMFSANDDPKMVMKGIEHGACDYLVKPVRLKE 50 
                      788888876644.569******************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.6E-18195No hitNo description
PfamPF000721.5E-7151IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011021.605159IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.52E-11159No hitNo description
SuperFamilySSF521728.97E-14166IPR011006CheY-like superfamily
Gene3DG3DSA:1.10.10.608.1E-9122149IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005622Cellular Componentintracellular
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MDGFKLLELV GLEMDLPVIM FSANDDPKMV MKGIEHGACD YLVKPVRLKE VQIIWQHVIR  60
KKKTSKRSNH DAPNSDSGNG KDSAGTGNSD QIEKPSRKRK DKNEDDGDEE NEDDYDNDNS  120
TAQKKPRTVW SADLHGKFVA AVNQLGVDNY SNPMLRLIS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196101RKRKDK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g013160.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024626906.11e-69two-component response regulator ARR10
RefseqXP_024633364.12e-68two-component response regulator ARR10
SwissprotB8AEH14e-50ORR23_ORYSI; Two-component response regulator ORR23
SwissprotQ6K8X64e-50ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A072VD051e-114A0A072VD05_MEDTR; Two-component response regulator ARR12-like protein
STRINGXP_004498785.15e-66(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-45response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]