PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g006650.1
Common NameMTR_1g006650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GATA
Protein Properties Length: 345aa    MW: 38370.7 Da    PI: 6.0463
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g006650.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.83.1e-18236270135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +C t kTp+WR gp+g+ktLCnaCG++y++ +l
  Medtr1g006650.1 236 CLHCMTDKTPQWRTGPNGPKTLCNACGVRYKSGRL 270
                      99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.1E-727327IPR016679Transcription factor, GATA, plant
SMARTSM004019.8E-17230280IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.387230266IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.0E-15231294No hitNo description
Gene3DG3DSA:3.30.50.101.2E-14232267IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.42E-14235282No hitNo description
PfamPF003204.7E-16236270IPR000679Zinc finger, GATA-type
PROSITE patternPS003440236261IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MEGTTNNIFQ TTFSSDNKTN NTTDNFIVED LLNLNNDIDD DTTIISDTNL DSATGNSTAS  60
SSTLTVVNSV SPSSLSGCDP NVVPDIGCQN FSDSHFSGDL CIPEDDLAGD LEWLSNIVEE  120
SFSSEDLQKM QLISGMKVRN QDEEPRELSQ PNRNNPIFNK EVLVPAKARS KRTRGPPCDW  180
SSRLLVLSQT TPSSSESEFL IPTPTLPTVT VPRKQAKTAP RRKDNDGGSG GDGRRCLHCM  240
TDKTPQWRTG PNGPKTLCNA CGVRYKSGRL VPEYRPAASP TFVLTKHSNS HRKVLELRRQ  300
KEMLRAHQHQ QNQILQHQSM MFDMSNNDDY LIHQHMGPDF RQMM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003588383.10.0GATA transcription factor-like protein
SwissprotP697812e-94GAT12_ARATH; GATA transcription factor 12
TrEMBLG7IB470.0G7IB47_MEDTR; GATA transcription factor-like protein
STRINGGLYMA17G27110.11e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.14e-86GATA transcription factor 12
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]