PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr0223s0040.1
Common NameMTR_0223s0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 283aa    MW: 32275.7 Da    PI: 8.3223
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr0223s0040.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.3e-321972255
           G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      prlrWtpeLH++Fv a+e LGG++kAtPk +l+lm+vkgLt++hvkSHLQ+YR+
  Medtr0223s0040.1 19 PRLRWTPELHRCFVYAIETLGGHQKATPKLVLQLMDVKGLTISHVKSHLQMYRS 72
                      8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-311573IPR009057Homeodomain-like
PROSITE profilePS512949.351575IPR017930Myb domain
SuperFamilySSF466891.72E-151772IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-231972IPR006447Myb domain, plants
PfamPF002492.0E-72071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MSSCGREGVV RQYVRSKVPR LRWTPELHRC FVYAIETLGG HQKATPKLVL QLMDVKGLTI  60
SHVKSHLQMY RSMRGDSCKQ DRTTSVHKKQ SFQEHDDDGF GDHESLGMES DSLFSYRNFS  120
PKRARIEKRN SLSGILECRE RICEEVPNPY TTFYDYVQDM VQQQQKGIKE ICFVGPIWHT  180
PQPQYCTIFP VLPKQETDLL QVTKLNEKKH VNEIGKTKSV RAEDEEDIRG CELSLSISLP  240
HISPQRSNAS SANDMRNSGF SNYMGCSTVQ KNITNLDLSL AI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-192074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-192074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-192074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-192074357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr0223s0040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013442314.10.0protein PHR1-LIKE 3
TrEMBLA0A072TFN80.0A0A072TFN8_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGXP_004498202.11e-164(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55393353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.11e-33G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]