PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr0198s0030.1
Common NameMTR_0198s0030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family HD-ZIP
Protein Properties Length: 756aa    MW: 82233.9 Da    PI: 5.1338
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr0198s0030.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.71.5e-2156111156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++k +++t++q++eLe++F+++++p++++r++L+kklgL  +qVk+WFqNrR+++k
  Medtr0198s0030.1  56 KKKYHRHTPQQIQELETFFKECPHPDEKQRTDLSKKLGLANKQVKFWFQNRRTQMK 111
                       79999************************************************999 PP

2START1717.9e-542654872205
                       HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEE.....EEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
             START   2 laeeaaqelvkkalaeepgWvkss....esengdevlq.....kfeeskvdsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                       la++a++el+++ + ++p+W ks     e +n+de+ +     + ++++++ +ea r +g++  ++a lve++ld   qW e+++     a+t
  Medtr0198s0030.1 265 LAQAAMDELISMSQPDSPLWIKSLdgvnEVLNYDEYAKvnslfNDPKQNGFVTEATRQTGLLLINSAGLVETMLDAD-QWAEMFPcmiaGAST 356
                       6899********************999988888888763332244444449**************************.**********9**** PP

                       EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       l+vissg      g lq+m+ae q++splvp R + f+R+ +q+ +g wv+vdvSv++ ++  +  +++ +++lpSg+++e+++ng +k+twv
  Medtr0198s0030.1 357 LDVISSGmngtrsGSLQVMQAEVQLPSPLVPvRQYSFLRFAKQHVGGIWVVVDVSVNVGRNAANGNPYMSCKKLPSGCILEDLPNGFCKITWV 449
                       **************************************************************99***************************** PP

                       E-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       +h  ++++++h+++r+lv+sg+a+ga +wvatlqrqc 
  Medtr0198s0030.1 450 DHSQYDESVVHQAYRPLVNSGMAFGAHRWVATLQRQCD 487
                       ************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.43E-2044113IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-2147113IPR009057Homeodomain-like
PROSITE profilePS5007118.04253113IPR001356Homeobox domain
SMARTSM003895.6E-1955117IPR001356Homeobox domain
PfamPF000464.4E-1956111IPR001356Homeobox domain
CDDcd000861.97E-1760113No hitNo description
PROSITE patternPS00027088111IPR017970Homeobox, conserved site
PROSITE profilePS5084843.299255491IPR002913START domain
SuperFamilySSF559614.73E-28258488No hitNo description
CDDcd088753.02E-97259486No hitNo description
SMARTSM002342.5E-37264488IPR002913START domain
PfamPF018521.2E-45265487IPR002913START domain
SuperFamilySSF559615.6E-12532748No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 756 aa     Download sequence    Send to blast
MEGNVGMGLI GENFDSGLLG RLRDDDYESR SGSENFDDLS GDDLDVADDQ PKSKKKKKYH  60
RHTPQQIQEL ETFFKECPHP DEKQRTDLSK KLGLANKQVK FWFQNRRTQM KTQLERHENM  120
ILRQENERLR AENSLLKDAM SNPTCSNCGG PAIPGQFSPE DHQLRVENAR LKEELGRVST  180
LTHKFFGRPV SAFGSITMPN PNSGFELGMG RNGVVGPSNF NMSLPMGFGM GDGVMGAPAL  240
QSGLQSPMGM IGNTAQQERA MLIDLAQAAM DELISMSQPD SPLWIKSLDG VNEVLNYDEY  300
AKVNSLFNDP KQNGFVTEAT RQTGLLLINS AGLVETMLDA DQWAEMFPCM IAGASTLDVI  360
SSGMNGTRSG SLQVMQAEVQ LPSPLVPVRQ YSFLRFAKQH VGGIWVVVDV SVNVGRNAAN  420
GNPYMSCKKL PSGCILEDLP NGFCKITWVD HSQYDESVVH QAYRPLVNSG MAFGAHRWVA  480
TLQRQCDSLA VSMSQSDDPT AMTPHGKKSM LKLAQRMSDY FWSGICPSTA CKWDILPISN  540
MGDSDLKIMY RQHPDANSSI VLSAATSVWI PLPRQRVFDF LREAQMRGGW DALSNGGPMQ  600
EVVHIAKGQA LGNSISILSL NNAVNPNGNE GSNLYLQDSW TDSSGSMVVY SPIDSQSLDI  660
LISGGDSSVI PLLPSGFSIL PDGHSNVNNI VGTSSDGSSG NGEGGDNGGC LLTFGLQMLL  720
NNTPTSKLTM ESVESVNAQI SVTIQRIKEA LGVVA*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in trichomes forming at the base of young leaves, in endodermal cell lines around emergent lateral roots and in the epidermal layer of the stamen filament. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr0198s0030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013442370.10.0homeobox-leucine zipper protein ROC6
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLA0A396HLH70.0A0A396HLH7_MEDTR; Putative transcription factor & lipid binding HD-SAD family
STRINGXP_004515730.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  3. Horstman A, et al.
    AIL and HDG proteins act antagonistically to control cell proliferation.
    Development, 2015. 142(3): p. 454-64
    [PMID:25564655]