PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr0123s0070.1
Common NameMTR_0123s0070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 308aa    MW: 34457.2 Da    PI: 8.6309
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr0123s0070.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.31.5e-125094147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Medtr0123s0070.1 50 RENWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 94
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.59E-1644100IPR009057Homeodomain-like
PROSITE profilePS5129414.1434599IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-648100IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-184897IPR006447Myb domain, plants
SMARTSM007174.8E-104997IPR001005SANT/Myb domain
PfamPF002493.9E-105094IPR001005SANT/Myb domain
CDDcd001678.69E-85295No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MVSKNPNPPE GFCLDPTSMA LPGFGPFAAV NSSEDASKKI RKPYTITKSR ENWTEPEHDK  60
FLEALQLFDR DWKKIEAFVG SKTVIQIRSH AQKYFLKVQK SGANEHLPPP RPKRKAAHPY  120
PQKASKSAPV LGQLPGSFQS SPALLEPGYI MKNESIPMLE TPIMNTVVSS WSNHTLQNTN  180
LLHVPKVNNS CSSTESTPKV RPVGESNNQV NKSLPLRVLP DFSQVYNFIG SVFDPEASEH  240
LQKLKQMDRI DVETVLLLMR NLSINLTSPD FEDHKKLLSS YEVDLETNSY LNPDRPIHDE  300
PLKSATT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.87460.0flower| leaf| root| seed
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr0123s0070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1496680.0BT149668.1 Medicago truncatula clone JCVI-FLMt-9M13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013442632.10.0protein REVEILLE 6 isoform X1
SwissprotQ8H0W31e-117RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A072TH000.0A0A072TH00_MEDTR; Myb transcription factor
STRINGXP_004516868.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-105MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]