PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 46920
Common NameMICPUCDRAFT_46920
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
Family bZIP
Protein Properties Length: 327aa    MW: 33926.6 Da    PI: 4.971
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
46920genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.82.8e-09161214457
             XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
  bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
              ++  r+ +NR +A +sR RK+ae+++L+ ++ eLe  N  L   ++  + e+a
   46920 161 ERARERLVRNRASAAASRMRKRAEMDCLRARCRELERINAHLTYAVQCAQAECA 214
             34445999*******************************999887777777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.0E-12154218No hitNo description
SMARTSM003384.5E-5155222IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-8162217No hitNo description
PfamPF001702.3E-7162217IPR004827Basic-leucine zipper domain
PROSITE patternPS000360166180IPR004827Basic-leucine zipper domain
CDDcd148126.90E-16167214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MTRVASPLPA ATFDFDALDD ACLDLDGIEA WLDDVHGDVV ASGILLEASN ATTPLDAFAV  60
DARDDDDAAG RRGRDKKRAR RDALSAAATS SSPPATPPHD PWRAASTRPP AAQIATAPSR  120
GGGDGSDSAA SDEDLVFSAG PAAGTTTTTT TTTDDDDEER ERARERLVRN RASAAASRMR  180
KRAEMDCLRA RCRELERINA HLTYAVQCAQ AECAGLRRGM AATTDGDAAV TGTTGTTGTP  240
PGPAGMFFPP PPGMFGIPLV PLPPLPGKKR ASRPVATPPT PATEDDADIE RRRTSSSTAT  300
AATTTTNSLF ALSASARAFV ALSPRL*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003057578.10.0predicted protein
TrEMBLC1MPH50.0C1MPH5_MICPC; Predicted protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1535822
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]