PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 21861
Common NameMICPUCDRAFT_21861
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
Family M-type_MADS
Protein Properties Length: 169aa    MW: 18944.8 Da    PI: 11.4773
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
21861genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.45.9e-264292151
            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
            +ri +++nrqvtf+kR+ng++KKA ELSvLCd ++a++if s++kl+ yss
   21861 42 ERIADERNRQVTFTKRKNGLMKKAMELSVLCDCQIALVIFNSNNKLFQYSS 92
            699**********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-323493IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.9643494IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-2935105IPR002100Transcription factor, MADS-box
CDDcd002652.25E-3535106No hitNo description
PROSITE patternPS0035003690IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-253656IPR002100Transcription factor, MADS-box
PfamPF003195.2E-254390IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-255671IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-257192IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010094Biological Processspecification of carpel identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MLDRRSLPPP RPRPLVFPPL TRDPTPYRPV AAAVGRKKIR IERIADERNR QVTFTKRKNG  60
LMKKAMELSV LCDCQIALVI FNSNNKLFQY SSGDINHVLT RFKNDTVGPH ERRNNKDVRE  120
RANARAGVDF SSSFSFGPFS VFTDAFSSPL AVGLPSLATR TPSITHHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A1e-3635125190Myocyte-specific enhancer factor 2A
3kov_B1e-3635125190Myocyte-specific enhancer factor 2A
3kov_I1e-3635125190Myocyte-specific enhancer factor 2A
3kov_J1e-3635125190Myocyte-specific enhancer factor 2A
3p57_A1e-3635125190Myocyte-specific enhancer factor 2A
3p57_B1e-3635125190Myocyte-specific enhancer factor 2A
3p57_C1e-3635125190Myocyte-specific enhancer factor 2A
3p57_D1e-3635125190Myocyte-specific enhancer factor 2A
3p57_I1e-3635125190Myocyte-specific enhancer factor 2A
3p57_J1e-3635125190Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003063080.11e-120predicted protein
SwissprotA2VDZ31e-33MEF2A_BOVIN; Myocyte-specific enhancer factor 2A
TrEMBLC1N4Z21e-119C1N4Z2_MICPC; Predicted protein
STRINGXP_003063080.11e-119(Micromonas pusilla)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP36561314
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.17e-23MIKC_MADS family protein
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]