PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0811s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family MYB_related
Protein Properties Length: 150aa    MW: 17048.3 Da    PI: 10.4045
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0811s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding414.4e-1374115447
                          S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          WT eE +++++a k +G++ +++Ia+ +g +R+  q++ + qky
  Mapoly0811s0001.1.p  74 WTNEERQRFKKALKTFGTD-FAAIAKFVG-TRSSTQVRTHAQKY 115
                          *******************.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.55866120IPR017930Myb domain
SMARTSM007172.8E-1170118IPR001005SANT/Myb domain
SuperFamilySSF466892.54E-1271119IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-872118IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.8E-773111IPR009057Homeodomain-like
PfamPF002494.8E-1273115IPR001005SANT/Myb domain
CDDcd001671.56E-974115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MDKSEPMQMA SSARPCAKTA PEQHYVQIDS LGLQQLEHLE KELEQAKQKI LVLRAQEHRE  60
TSSPENKVSE SRYWTNEERQ RFKKALKTFG TDFAAIAKFV GTRSSTQVRT HAQKYYAKLI  120
RDYKRSGKSP ATVKGREEKA TGATRLTTM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024380186.11e-70myb-like protein I
TrEMBLA0A176WKX31e-106A0A176WKX3_MARPO; Uncharacterized protein
TrEMBLA0A2R6VYD71e-106A0A2R6VYD7_MARPO; Uncharacterized protein
STRINGPP1S87_134V6.14e-70(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1164447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.15e-11MYB_related family protein