PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0168s0007.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family NF-YC
Protein Properties Length: 156aa    MW: 17245 Da    PI: 4.2927
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0168s0007.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC52.79.4e-17531391298
                NF-YC  12 katdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 
                          k++ ++  ++P++r+++++k++ d++ +  ea  l++ka elf+ ++   ++ +  e +r+tl+  d+a+ vt ++  dfl d vp+
  Mapoly0168s0007.1.p  53 KSASLNALAFPISRVRRLVKSEGDMQWVGVEAGFLIAKAAELFLEKFVEEAFEKMTEEDRTTLHYKDLAEHVTCAERMDFLADFVPE 139
                          566777889****************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.8E-2162139IPR009072Histone-fold
PfamPF008088.6E-1262121IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471137.21E-1671140IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MSSSDESDSG RRSSDAEEDE KMDEEKEEVD SQSQDDSPSP SPVRSQTHSA RSKSASLNAL  60
AFPISRVRRL VKSEGDMQWV GVEAGFLIAK AAELFLEKFV EEAFEKMTEE DRTTLHYKDL  120
AEHVTCAERM DFLADFVPEM VLASTATSAK AMADR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP86701112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.11e-18nuclear factor Y, subunit C10