PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0165s0024.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family MYB_related
Protein Properties Length: 474aa    MW: 52791.8 Da    PI: 9.8517
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0165s0024.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.14e-08130171345
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           W +eE ++l d+++q+  + +  Ia +m+++Rt +++k+r++
  Mapoly0165s0024.1.p 130 TWNKEETDQLFDLCEQFDLR-FIIIADRMPTTRTVEELKERYY 171
                          6*******************.*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162825.0E-28103176IPR032563DAMP1, SANT/Myb-like domain
Gene3DG3DSA:1.10.10.602.2E-6126175IPR009057Homeodomain-like
SMARTSM007172.3E-7127176IPR001005SANT/Myb domain
SuperFamilySSF466893.51E-6130175IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MADAKDILGL PKVVGSGSEK RRSTKDGQKK PDGVSREVYA LTGGLPPIMP ALDPSNLKKK  60
KPVDSVKKVA WKWNQFTSSA RSDSLQLRHW VRVVDNVEPI GDYAFAKYNK AVDVVRYTDE  120
EYSKYLTDTT WNKEETDQLF DLCEQFDLRF IIIADRMPTT RTVEELKERY YSAAKAVLLS  180
RAGLPEDVAD HTLMKDIYNV QYETERKKAL GILLSQSRQQ EREDAEVLAE AKRIQEVRLS  240
AKIAEEAELP SNKSAAETTV NNEMVDKSPR TPLRPTSPAQ AAHAGPSTVA AAPAAPVPSV  300
TAVGTSPAIS GPRPPRVYLR SAYHAQMVQS SATQAGVRTS KRVDQLLEDY GCRAKVKNPT  360
KTVCEEHIEL RKELLTLIQL QKQLTWKENE VSVLRENPYA DIPTPSTPKR SHRGNDHERV  420
LTRATAVGAD TDSFSGERVN KREHKRKAPA RFSEAPASPP HQKRARKMKA SDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A1e-18102182488DNA methyltransferase 1-associated protein 1
4iej_A1e-18102182488DNA methyltransferase 1-associated protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. {ECO:0000305|Ref.5}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006827136.10.0SWR1-complex protein 4
SwissprotQ8VZL61e-152SWC4_ARATH; SWR1-complex protein 4
TrEMBLA0A2R6W3I30.0A0A2R6W3I3_MARPO; Uncharacterized protein
STRINGERM943730.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6713810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.11e-137MYB_related family protein
Publications ? help Back to Top
  1. Gómez-Zambrano Á, et al.
    Arabidopsis SWC4 Binds DNA and Recruits the SWR1 Complex to Modulate Histone H2A.Z Deposition at Key Regulatory Genes.
    Mol Plant, 2018. 11(6): p. 815-832
    [PMID:29604400]