PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0119s0041.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family G2-like
Protein Properties Length: 542aa    MW: 59066.9 Da    PI: 6.3636
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0119s0041.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.88.8e-32306361156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rFv+a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Mapoly0119s0041.1.p 306 KARRCWSPELHRRFVSALQQLGGSQIATPKQIRELMKVDGLTNDEVKSHLQKYRLH 361
                          68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.714303363IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.0E-29303364IPR009057Homeodomain-like
SuperFamilySSF466892.51E-17304364IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-26306361IPR006447Myb domain, plants
PfamPF002493.2E-7308359IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MGSPADLTLG CRPQSSGNEF KAVSTSGDQI ERVRKLDEYL KALEDERHKI EAFKRELPHC  60
MQLLDYAIEV SKDRLVDSPR SSSGGGHAVD SYGEVETSTL GSFGKHVVEE FLKKSWEAPK  120
REIEEVEKVS KRSDEGRDAD HRPSWMAEAQ LWSQPSTRSD AWKEKESSTE DSTRRQRDTT  180
EQSTVTSPAN LFNTHKRTGG AFLPFIKEKP VATVASRVKV LSGADLALSS VESRPASRIA  240
LGPVESEAGS LDVSTTRTRD VGMEVVQAKD NGRKLNGSGS GGNHSGGTGS TSSGGGGGGS  300
GQAQRKARRC WSPELHRRFV SALQQLGGSQ IATPKQIREL MKVDGLTNDE VKSHLQKYRL  360
HTRRPSPAPQ APQQQAPQLV VLGGIWVPPE YTSGGMYHDP SSSVSQQGHF CQASLSQEIY  420
SQLNPSAQIQ LHRSQSHSSP QGPLQSTSQL SSGARQTSAE MYREDSPGED GKSESSSWKG  480
EDDSRGRSEK ESDREVGSGG RDDDEDDTDV EDEGRESGMR LKLEMAFTRS HTVMKPEPQM  540
A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-15306359255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-15306359255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-15306359255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-15306359255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-15306359255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-15306359255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-15306359255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-15306359255Protein PHOSPHATE STARVATION RESPONSE 1
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2R6WAI80.0A0A2R6WAI8_MARPO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP43031624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-67G2-like family protein