PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0095s0046.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family GATA
Protein Properties Length: 669aa    MW: 72652.4 Da    PI: 7.1978
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0095s0046.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA391.1e-12741135
                 GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                         C +C  ++TplWR+gp  ++ LCnaCG ++r kg+
  Mapoly0095s0046.1.p  7 CCHCFISTTPLWRNGPPEKPVLCNACGSRWRTKGT 41
                         99**************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.5E-7153IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.47E-9544No hitNo description
CDDcd002023.60E-13654No hitNo description
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PROSITE profilePS5011410.449740IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.5E-11742IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.2E-10741IPR000679Zinc finger, GATA-type
PfamPF139192.5E-7316400IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MGKQGPCCHC FISTTPLWRN GPPEKPVLCN ACGSRWRTKG TLQNYMPMHS GGFSANTESS  60
ADLKWSRGKK GSHKHEHRSH KRKEPCDGRA ERDSTQNRSA DQSLSKGYEE DTVSRSCSGS  120
GMCGSEGSVK RGSFPPKDLP VLGNLLVGFG WEVPAVPQKT RSTTSTRRRT ACDVLTRIAR  180
SFSSPTVDPL LIAPPAPGAS SDAVLVEYNK PSLVAVEIGL GSVFVRQCVS LAEEPESESS  240
LFLVDSRGNE SFNGLGHSES GSGIPFIQDF HGIDRGSVYR GKDKAKQVPR KLDAGRLHND  300
KNLVPNKALL ENFPYNKRDV LQSYQSPLVF LEMKDIVNFD TFTGLLTEQE QGQLMQFVSS  360
ADVARIPESL KSMFSSDQFD GALANFQHLL SEGMFDVSEL SSSPRVLQHF QQLLQLPELT  420
KSGWLERCSQ LQNRNKRRGS VDSTKVNSTK ETNKEKMKAS HVPGAASSGS SGFSGAKLPV  480
GHASEKSGEE HKPTKSLSFR GPAISATSTL YNTNPVKHGL NIKPETGSSS NEAVATEAGV  540
NTEGPCFPGN SPFLSTAERE RAIGDEYNLD MGVLDCSETD SLLYNLPNPM SFQQAELLPQ  600
PSWEKKSMKE EEGDVNQLES GGLIMSNTWH MDPNPAEWGL FWNNSSSCVG PGQALPSGAG  660
LIPGRMLM*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2R6WG120.0A0A2R6WG12_MARPO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP27491530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.16e-25GATA transcription factor 26