PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0092s0082.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family MYB_related
Protein Properties Length: 525aa    MW: 59676.1 Da    PI: 9.5648
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0092s0082.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.27.9e-08167209346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +WT e  ++l d+++ql  + +  Ia +++  Rt++++k+r+++
  Mapoly0092s0082.1.p 167 NWTREQTDQLFDLCEQLDLR-FIVIADRFPDSRTPEELKDRYYN 209
                          8*******************.*********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162821.9E-26140214IPR032563DAMP1, SANT/Myb-like domain
Gene3DG3DSA:1.10.10.601.9E-6163213IPR009057Homeodomain-like
SMARTSM007172.2E-7164213IPR001005SANT/Myb domain
SuperFamilySSF466891.14E-6165218IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MGDAKDILGL PKVADRSDTP KSSDKRRQSK DSQRKPDGVS REVYSLIGGL PPIMTCLPDI  60
NVKKHLQQPV HPDRKKGWRW VPISSSARKD NLELHHWEQV DLEKEPPDFE RSDSSIAEGS  120
GSIAPIRPQY KVAARPPTDY VYAKYNRTVD IVRYTDEEYA QYLEDENWTR EQTDQLFDLC  180
EQLDLRFIVI ADRFPDSRTP EELKDRYYNC AKKILESRVS SPDEVAQHPL VKNAYNFEHE  240
VERKKSLELL LSQTRRQERK DHEILEEAQR IREERFKQRK AEKASRAADK RKQARMEVIA  300
EVENTGDLTR EGGTSDALLG TSGSPTLKTA EEGEAGSPKV PTRPRRPAMR NQASHASTSV  360
EAPATSCPSQ DTQERSMVPG ESNVAKSLTK KVQGVYLLST HHAKAVQEYS SQAGQRASRR  420
INQMLEKYKC PPKVKQFTKR VCDMHLEVRE HLLALVKLEE EIQLREAEIR TAKTTNKGTD  480
KTSPSTPRRS QRVTAAVVGA ESNTSSGERV SKREKRRSVR TIEQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A3e-17139218487DNA methyltransferase 1-associated protein 1
4iej_A3e-17139218487DNA methyltransferase 1-associated protein 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2R6WGZ90.0A0A2R6WGZ9_MARPO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6713810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.16e-89MYB_related family protein