PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0065s0089.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family GRAS
Protein Properties Length: 782aa    MW: 84109.5 Da    PI: 6.1569
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0065s0089.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS319.66.3e-984047742374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL++cA+a++s+d + aq+++  l ++a  dgdp+qR++++f++AL +r ar  + l+ + ++ +ts    + ++  +    +++P++
  Mapoly0065s0089.1.p 404 EQLLVHCAQALDSNDVTVAQQIMFVLGNIAPADGDPNQRVTSCFLKALVRRAARLIPDLSPIASAGRTS---KVVSAVEYAGMIDITPWY 490
                          79****************************************************888887655555554...44444455569******* PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfef 178
                          +f++ +aN  ++ea+eg+ervHiiDf+ ++G+QWp+L+++La+R++gpp++R+T+ ++  +       + ee++++L  fA++ +v+++ 
  Mapoly0065s0089.1.p 491 RFGFKAANGLMMEAFEGKERVHIIDFSTTYGMQWPTLIESLAERADGPPQVRLTVHKARPNIppfLGMSEEEVANKLMAFASSRNVELQV 580
                          ******************************************************998855558887778899****************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles.erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                          ++ +++++++l+ ++L+++ +E+++Vn++++  +++des++ ++  rd++L++v sl P +v++v++ea ++s+s+++r+  a++y +  
  Mapoly0065s0089.1.p 581 SI-LHNEVHQLDRSALDIRDDETTVVNCMYRARYVPDESADPPHcSRDAFLRFVHSLDPALVIIVDEEATLTSPSLVARVKAAFNYIWIP 669
                          *9.699***********************************99999******************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          fd+le+ lpr+s +r  +E   l+++i+n++aceg +r+er e + kW +r+++aGF+ vp+s+++++++k++l+ ++  g+ +++++++
  Mapoly0065s0089.1.p 670 FDALETFLPRDSPQRLEYELD-LEKKIENIIACEGLQRIERLEAKDKWGQRMKKAGFELVPFSDDINSEVKSMLSDHA-AGWGMKHDEDA 757
                          *********************.********************************************************.889999***** PP

                 GRAS 358 lvlgWkdrpLvsvSaWr 374
                          ++l+Wk++++++++aW+
  Mapoly0065s0089.1.p 758 MLLTWKGHNVLFATAWQ 774
                          ****************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.172377755IPR005202Transcription factor GRAS
PfamPF035142.2E-95404774IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    Send to blast
MDHTCTTRKE RRNPDHDHDL DSSLPSSGAL ELSDTRSFQQ LRQQQQPPQQ HPAFPLVKGD  60
LAATMAAIHA AADLKLEMSS LPAWTSDLTA QMQENFAEPR SHCFANSRTR PRDTSPRQEQ  120
LDISSLYRSI PSRASVDGLQ SHPKSAGVGV GPGGGTGGIA PIPFSQQQQV DMVQLQHRSN  180
LSSYIGFDSG LQSITSLVGG GSLDQCYSGV SPRCEKRQRL SPSSQTFHTP EGLTTIRDSL  240
PSSAAAAATA AASRGRGGGG GGGVGAAAAA AAAAAAADGV SHLQGSGSAG QRGRNEQGLN  300
EVLQRFTTSP SAQVQQQQAS MAIKAVSPFD SLGLAEIAPP APPFDNALLF SSSDSDSSSS  360
RSLRPKGVLE GAGLPLQGGG GGIKSLGSLT VKNCGATHDA NTMEQLLVHC AQALDSNDVT  420
VAQQIMFVLG NIAPADGDPN QRVTSCFLKA LVRRAARLIP DLSPIASAGR TSKVVSAVEY  480
AGMIDITPWY RFGFKAANGL MMEAFEGKER VHIIDFSTTY GMQWPTLIES LAERADGPPQ  540
VRLTVHKARP NIPPFLGMSE EEVANKLMAF ASSRNVELQV SILHNEVHQL DRSALDIRDD  600
ETTVVNCMYR ARYVPDESAD PPHCSRDAFL RFVHSLDPAL VIIVDEEATL TSPSLVARVK  660
AAFNYIWIPF DALETFLPRD SPQRLEYELD LEKKIENIIA CEGLQRIERL EAKDKWGQRM  720
KKAGFELVPF SDDINSEVKS MLSDHAAGWG MKHDEDAMLL TWKGHNVLFA TAWQPSFQNL  780
S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_B2e-5139977629421Protein SHORT-ROOT
5b3h_E2e-5139977629421Protein SHORT-ROOT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024394257.11e-139scarecrow-like protein 32
TrEMBLA0A2R6WR610.0A0A2R6WR61_MARPO; Uncharacterized protein
STRINGPP1S36_131V6.11e-138(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-110GRAS family protein