PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0058s0044.1.p
Common NameDELLA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family GRAS
Protein Properties Length: 561aa    MW: 61701.7 Da    PI: 6.0817
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0058s0044.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS447.87.5e-1371965571373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          lv+lLl+cAeav+ +d ++a+ ++ r++ la+p++ pm ++aa+f+eALa+r+++        +++++ts +  +e l+++  f+e++P+
  Mapoly0058s0044.1.p 196 LVHLLLACAEAVQRSDVRMAEDTVRRIQMLATPQRGPMGKVAAHFVEALARRIFG--------ISAEPTS-DPLTELLHFQ--FYETCPY 274
                          68*****************************************************........3333332.3377888775..******* PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                          lkf+h+taNqaIleav++++r+H+iD ++++GlQWpaL+qaLa Rp+gpp lR+Tg+g+p+++ ++ l+e+g +La++A+ + v+fef+ 
  Mapoly0058s0044.1.p 275 LKFAHFTANQAILEAVQNHKRIHVIDCNLMHGLQWPALIQALALRPGGPPILRLTGIGPPHQSGNDVLQEIGMKLAQLADLVSVQFEFRG 364
                          ****************************************************************************************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                          ++a++l+d+++ +L+v++gEa+aVn v+qlhrll+++ +   + +evL+ ++sl+Pk+v++ve+ea+hns+ Fl+rf+eal+yys++fds
  Mapoly0058s0044.1.p 365 VYAQKLDDVKPYMLHVRQGEAVAVNAVMQLHRLLHNDNNCVPAVHEVLQSMRSLNPKIVTLVEHEANHNSPVFLDRFMEALHYYSTMFDS 454
                          ***************************************999************************************************ PP

                 GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                          lea  ++ ++ ++ + ++++grei+n+vaceg++r+erhe+l +Wr+r+++aGF+  +l+++a kqa++ll  +++dgyrvee++g+l+l
  Mapoly0058s0044.1.p 455 LEACSSSSQSSEQLLAEMYVGREICNIVACEGFDRVERHENLVQWRRRMTDAGFQLRHLGSNAFKQASMLLTLFPGDGYRVEENNGCLTL 544
                          *99999999999999*************************************************************************** PP

                 GRAS 361 gWkdrpLvsvSaW 373
                          gW++rpL+++SaW
  Mapoly0058s0044.1.p 545 GWHSRPLIAASAW 557
                          ************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011294.6E-642116No hitNo description
PfamPF120411.8E-1044109IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098567.659170538IPR005202Transcription factor GRAS
PfamPF035142.6E-134196557IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042538Biological Processhyperosmotic salinity response
GO:0090378Biological Processseed trichome elongation
GO:2000033Biological Processregulation of seed dormancy process
GO:2000273Biological Processpositive regulation of receptor activity
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0016874Molecular Functionligase activity
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MDSSADYARR VRARPSSSSA SDLTGVTSPQ YRHHSGSVGV DQQLLAHTGG YSNVRSGDMG  60
LRLEQQLDTV LGVSQDGPIS HLSAEAAQHY NPADLAGWIE CMICDMQPSS SQAQLHTSQQ  120
QQQQQHSPTP THSSFVSMES SLDSMDSQAP LQPALPSAAA AAVMPDMYPA DDISDSMAGA  180
LCPQEDTGVE ESGVRLVHLL LACAEAVQRS DVRMAEDTVR RIQMLATPQR GPMGKVAAHF  240
VEALARRIFG ISAEPTSDPL TELLHFQFYE TCPYLKFAHF TANQAILEAV QNHKRIHVID  300
CNLMHGLQWP ALIQALALRP GGPPILRLTG IGPPHQSGND VLQEIGMKLA QLADLVSVQF  360
EFRGVYAQKL DDVKPYMLHV RQGEAVAVNA VMQLHRLLHN DNNCVPAVHE VLQSMRSLNP  420
KIVTLVEHEA NHNSPVFLDR FMEALHYYST MFDSLEACSS SSQSSEQLLA EMYVGREICN  480
IVACEGFDRV ERHENLVQWR RRMTDAGFQL RHLGSNAFKQ ASMLLTLFPG DGYRVEENNG  540
CLTLGWHSRP LIAASAWHCS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-541965584375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8897470.0AB889747.1 Marchantia polymorpha DELLA mRNA for GAI1-like E3 ubiquitin ligase protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001754090.10.0GAI1-like E3 ubiquitin ligase protein
SwissprotQ8S4W71e-167GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A068PER50.0A0A068PER5_MARPO; GAI1-like E3 ubiquitin ligase protein
STRINGPP1S12_244V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-147GRAS family protein
Publications ? help Back to Top
  1. Ueda M,Tanaka A,Sugimoto K,Shikanai T,Nishimura Y
    chlB requirement for chlorophyll biosynthesis under short photoperiod in Marchantia polymorpha L.
    Genome Biol Evol, 2014. 6(3): p. 620-8
    [PMID:24586029]