PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0053s0058.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family NF-YC
Protein Properties Length: 158aa    MW: 17923.6 Da    PI: 6.2674
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0053s0058.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC117.27.8e-37241101298
                NF-YC  12 katdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 
                           + +fk h +Plari++i++ad dv+misae+Pvl+++ace+fi +lt r+w +a+e+ rrt++ksdi ++v+ t+i dfl di p 
  Mapoly0053s0058.1.p  24 PVMEFKAHPIPLARIRRIMRADADVNMISAETPVLFARACEMFIEDLTARAWKKAQESGRRTVNKSDIVQIVSGTKILDFLDDILPP 110
                          5689*******************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471135.28E-2527104IPR009072Histone-fold
PfamPF008084.8E-203393IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.106.1E-3034109IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MERMDRPPRP RPHERQMEGA QTPPVMEFKA HPIPLARIRR IMRADADVNM ISAETPVLFA  60
RACEMFIEDL TARAWKKAQE SGRRTVNKSD IVQIVSGTKI LDFLDDILPP EWASGSKPEQ  120
DRMEETPPKP FPDAVSDFVS LSCAQNSQNY FTMCHLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_C4e-262710936118HapE
4g92_C4e-262710936118HapE
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004495741.14e-30nuclear transcription factor Y subunit C-3-like
RefseqXP_004495742.14e-30nuclear transcription factor Y subunit C-3-like
SwissprotQ9ZVL32e-30NFYC3_ARATH; Nuclear transcription factor Y subunit C-3
TrEMBLB7FI763e-30B7FI76_MEDTR; Nuclear transcription factor Y protein
TrEMBLD8REN46e-31D8REN4_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ281982e-30(Selaginella moellendorffii)
STRINGEFJ296922e-30(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP31517117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54830.32e-23nuclear factor Y, subunit C3
Publications ? help Back to Top
  1. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  2. Liu X, et al.
    The NF-YC-RGL2 module integrates GA and ABA signalling to regulate seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12768
    [PMID:27624486]
  3. Myers ZA, et al.
    NUCLEAR FACTOR Y, Subunit C (NF-YC) Transcription Factors Are Positive Regulators of Photomorphogenesis in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(9): p. e1006333
    [PMID:27685091]
  4. Gnesutta N,Saad D,Chaves-Sanjuan A,Mantovani R,Nardini M
    Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants.
    Mol Plant, 2017. 10(4): p. 645-648
    [PMID:27871811]
  5. Tang Y, et al.
    Arabidopsis NF-YCs Mediate the Light-Controlled Hypocotyl Elongation via Modulating Histone Acetylation.
    Mol Plant, 2017. 10(2): p. 260-273
    [PMID:27876642]
  6. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  7. Gnesutta N, et al.
    CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer.
    Plant Cell, 2017. 29(6): p. 1516-1532
    [PMID:28526714]