PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0042s0058.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family MYB_related
Protein Properties Length: 399aa    MW: 43343.5 Da    PI: 7.2441
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0042s0058.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.75.4e-133781147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                         r +WT++E++++++a +++  + Wk+I + +g  ++  q++s+ qky
  Mapoly0042s0058.1.p 37 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKSVIQIRSHAQKY 81
                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.08E-163187IPR009057Homeodomain-like
PROSITE profilePS5129414.8733286IPR017930Myb domain
TIGRFAMsTIGR015571.1E-173584IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.6E-63677IPR009057Homeodomain-like
SMARTSM007179.9E-113684IPR001005SANT/Myb domain
PfamPF002496.0E-113781IPR001005SANT/Myb domain
CDDcd001675.49E-83982No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MLGVMAAGSP ALSGMGPQGS EEGSKKVRKP YTITKSRESW TEQEHDKFLE ALQLFDRDWK  60
KIEAFVGSKS VIQIRSHAQK YFLKVQKNGT GEHVPPPRPK RKSAQPYPQK APKAVSAVQQ  120
PGVLARTLNP QPTQSEPCLP RRGNFQSCSI GSNSGSWQYH SMPPVVPITT DLRATPDFAE  180
VYKFIGNVFD PGMNSNHNLK KLKEMAPIDR ETVLLLMRNL SINLSSPEFE ERKLFMPAFE  240
ANPDAARPDS SDQHLAMLSA TQPPSDGGDD DAAFSGQPSS NHQSDSGDSD SQVDPSHGQT  300
RVLPSYSDGP MDVAEHRRLT HEGGSRSVDS VLPIAPYPGL TSSRPMTDNS SAGAHRSMGL  360
HSHPHMAFSG RADVGFGMPL PTLTPGVVGE GNIDNWWS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024389911.11e-108protein REVEILLE 8-like isoform X6
SwissprotQ8H0W31e-78RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A176W8F10.0A0A176W8F1_MARPO; Uncharacterized protein
TrEMBLA0A2R6X1N30.0A0A2R6X1N3_MARPO; Uncharacterized protein
STRINGPP1S46_272V6.11e-103(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9281558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.14e-81MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]