PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0040s0134.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family Dof
Protein Properties Length: 453aa    MW: 47830.4 Da    PI: 7.0897
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0040s0134.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.31.9e-3947107262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++++++cprC+s ntkfCyynnysl+qPr+fCk+CrryWt+GG+lrnvPvGgg+rknk+++
  Mapoly0040s0134.1.p  47 PDQIIACPRCQSLNTKFCYYNNYSLTQPRHFCKNCRRYWTAGGTLRNVPVGGGCRKNKRAK 107
                          68999*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2747105IPR003851Zinc finger, Dof-type
PfamPF027012.0E-3349105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.27351105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MLLSGCASEQ HAGDSVDGSQ SLLHPDKKTN SNLFAQRALQ ERRLKPPDQI IACPRCQSLN  60
TKFCYYNNYS LTQPRHFCKN CRRYWTAGGT LRNVPVGGGC RKNKRAKQRS SDLSSVLTSV  120
ESSGPGMRND GGGSALHPAY NPGSASSSAS YFEQQYDLDP AKMALRQSIR AGPSGVSQST  180
ESGISSNGHV SAFSGVTHGS QAGGMSHSAQ STYESAGIMS LGGFYTPVKQ DVAALASGDL  240
SAIFDNPHAH VQSFRAAAAA AAAAGAGPAL GEEAIGYQIN LEHLNGAIDP ADVNVQWRLQ  300
AAAAQKQQQQ QQQQQVGMWG SLEEDQEHRG EARQNLHHVD EKGLMESLRH AKGKSAILSP  360
SSAVDEVEPV TTRSLIGSGG TIWQPVPESL QPFEPVSHDS TFWGNQNWPP LGDLHPTLNG  420
NSNSGGGGGG GSSNNNNNAN SNSNNNNNSQ LL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2R6X3040.0A0A2R6X304_MARPO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-34TARGET OF MONOPTEROS 6