PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0023s0090.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family MYB_related
Protein Properties Length: 570aa    MW: 62445.4 Da    PI: 4.6276
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0023s0090.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.52e-10447489246
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rW +eE +++++a++q+G++ +++I + ++ +Rt+ q+k ++ k
  Mapoly0023s0090.1.p 447 ERWKAEETDIFYRAIRQFGTD-FDLIKNLFP-NRTRRQIKAKYKK 489
                          69*******************.*********.**********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.35E-10437489IPR009057Homeodomain-like
PfamPF159631.2E-27439518No hitNo description
Gene3DG3DSA:1.10.10.603.6E-7443489IPR009057Homeodomain-like
PROSITE profilePS512939.627444492IPR017884SANT domain
SMARTSM007171.4E-8445493IPR001005SANT/Myb domain
CDDcd001671.08E-7448489No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MSMLSTLVDA LDVPEGASVP RAGVFQPKVK ARVRKGGGRG DAGASVAVKA PPAAPAAEKP  60
VSALPVASDT EPLDGNQNNA EENEISQPDF KVPDAPLSIE ENCVPEPLLP ITSSTTTLEE  120
TVGVIDSVST EVTKVTSPSR TSSIEPAIHS SPAAEDGSLL LQAEDDVIAA INAPEVSPPV  180
AVRSNFPLPS FTTATEENED TQGDALPRSG EPSSKGIVQP TNDEEGGPNG VIERARENKF  240
KKSARKVRKT EVATPTTSSK EAEVVDDDLE ETLVTLDDEL MAELGLQEED PPLDPAVQRR  300
KRKRAFPHAS SRPRRVQEDV GGSSKGGQSS KTNYDLSNPG TLPLREVIRR AENIERKKAK  360
DELAKKSLLD ISKPREREVV REAEPQRDVL SLAPQVQVIN GRIVVNEQSL TVGAYATSAQ  420
DTDKYTRVEE NASRLNYHTY SNRTVTERWK AEETDIFYRA IRQFGTDFDL IKNLFPNRTR  480
RQIKAKYKKE ENSNPRRVSD ALTYRPKDQS HYEDLLVRMK CDDLIQDNSD PFASILAYTA  540
DKVEKTDVTD KVEVEETQTE EEIPASIVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5n9g_C3e-1639251623150Transcription factor TFIIIB component B'' homolog
5n9g_H3e-1639251623150Transcription factor TFIIIB component B'' homolog
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1298303RRKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2R6XCD50.0A0A2R6XCD5_MARPO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8075913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.14e-21MYB_related family protein