PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0020s0013.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family MYB_related
Protein Properties Length: 388aa    MW: 41133.4 Da    PI: 10.0409
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0020s0013.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34e-1497141347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE+ l++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
  Mapoly0020s0013.1.p  97 PWTEEEHRLFLLGLQKLGKGDWRGISRNFVQTRTPTQVASHAQKY 141
                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501589.125320IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.102.4E-4320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.9190146IPR017930Myb domain
SuperFamilySSF466891.2E-1792147IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-1893145IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-1194140IPR009057Homeodomain-like
SMARTSM007171.6E-1194144IPR001005SANT/Myb domain
CDDcd001678.50E-1097142No hitNo description
PfamPF002491.3E-1197141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MTRRCSHCGH NGHNSRTCPD RCPDRGVRLF GVRLTTNDGA ANMRKSVSMG NLTHYANASN  60
PPSTPEHSES GAGAEGYVSD GLVQTSSNAR ERKKGVPWTE EEHRLFLLGL QKLGKGDWRG  120
ISRNFVQTRT PTQVASHAQK YFIRQSNLNK RKRRSSLFDI VTESGPRPMV EEPLSKSPDM  180
SAPLHQLSLS SGGLFNHGAF FEQQGMPQLN RGPDMFPPMA PMSGVSMRSY PIGAHLQQAI  240
PLPVMSLGTA EQTGESTVSY AGESVTVLPR PVAISAASAS GPGSAALAGQ LGIGGPSMYP  300
YHIWPGIAPG SYSKPMSSSP SSSSKVVKPT ACPAKIDEGS EMAKLTLGPS PSAEPSNLTL  360
KFSGHSAFVS KTSFNSNNLG PSTISVV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024390573.11e-115transcription factor KUA1-like isoform X1
RefseqXP_024390574.11e-115transcription factor KUA1-like isoform X1
TrEMBLA0A2R6XE050.0A0A2R6XE05_MARPO; Uncharacterized protein
STRINGPP1S70_203V6.11e-114(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-61MYB_related family protein