PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0003s0271.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family GRAS
Protein Properties Length: 679aa    MW: 74345.1 Da    PI: 5.7213
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0003s0271.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS415.74.2e-1272986781374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlsel..aspdg..dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                          lv+lL++cA+a+++gd + a+a++ ++++    +p++   pm ++aa+f+eAL +r+++ +++  +a+ +s++         a ++ f++
  Mapoly0003s0271.1.p 298 LVHLLMACAKAIQAGDRHSAEATVRKIKQAvsMAPQQsaGPMIKVAAHFAEALTRRIYGVSPNFQEAMLSSAS-------MKADFENFYD 380
                          68***************************94422333246*******************55555544444433.......3444577*** PP

                 GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                          +sP+l+f+h+ +NqaIlea+ g+++vH+iDf +++GlQWp+L+qaLa Rp+gpp+l++Tg+g+pe g +++l+ +g+ La +A el+v+f
  Mapoly0003s0271.1.p 381 LSPYLRFAHFSTNQAILEAFTGANHVHVIDFHLNYGLQWPCLMQALAMRPGGPPTLKLTGIGPPELGGEDSLQDIGRSLATMAGELNVNF 470
                          ****************************************************************************************** PP

                 GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                          +f+ +va+rl+d+++++L+v+pgE++aVn+++qlh+ll+ ++s e   devL++vksl+Pkvv+++eqea+hn ++Fl+rf+eal++ys+
  Mapoly0003s0271.1.p 471 KFRGVVAERLDDIQPWMLQVQPGEVVAVNSIFQLHKLLHAEGSNEAGLDEVLRAVKSLNPKVVTIAEQEANHNIHNFLDRFVEALHFYSS 560
                          ****************************************************************************************** PP

                 GRAS 267 lfdsleak..........lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                          +fdslea+           +++ +e+ k  +++lgrei+n+vacega+r+erhe+le W+ rl++aG++++++ ++a+++a+lll+ +++
  Mapoly0003s0271.1.p 561 MFDSLEASkrptdssdprTAHQRQEMYKGAERYLGREICNIVACEGAKRVERHENLEMWKLRLRNAGYQQLRMPSTAYNTASLLLNLYSG 650
                          *****8887888888665555557788888999********************************************************* PP

                 GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaWr 374
                          +gyrve++ g+++l+W ++pL+++SaW+
  Mapoly0003s0271.1.p 651 QGYRVEDNCGCITLCWDGKPLLTASAWQ 678
                          ***************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.054272658IPR005202Transcription factor GRAS
PfamPF035141.4E-124298678IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MNYGGAPDFQ LASFLDGLDA MMISMDQGGG NQQSSSPSPY ANAGVSYGQS PSPVSQSSFV  60
DVSSVQSPPD SVYNDTLDSE IAQSDMSALT QNFVVNEPWF DDSGNLVSFP ISSDAPSKNS  120
AIGRSPAPAG LDQSYTQDLF EQQFCHEEED MRPQFPSHSF GSAYGFNNTP FSLLKGTDTA  180
SSVGSCGNGS SGSSLSRGRS VGSVSSPRSF GVAPQRMLLP PLRSNSSTRI QAYPNSIFQQ  240
EPGVMKWSAQ PAQASAPQQQ QQQQQQQRQQ QQQQQQQQAL RRPALPVEPE QEDSGLRLVH  300
LLMACAKAIQ AGDRHSAEAT VRKIKQAVSM APQQSAGPMI KVAAHFAEAL TRRIYGVSPN  360
FQEAMLSSAS MKADFENFYD LSPYLRFAHF STNQAILEAF TGANHVHVID FHLNYGLQWP  420
CLMQALAMRP GGPPTLKLTG IGPPELGGED SLQDIGRSLA TMAGELNVNF KFRGVVAERL  480
DDIQPWMLQV QPGEVVAVNS IFQLHKLLHA EGSNEAGLDE VLRAVKSLNP KVVTIAEQEA  540
NHNIHNFLDR FVEALHFYSS MFDSLEASKR PTDSSDPRTA HQRQEMYKGA ERYLGREICN  600
IVACEGAKRV ERHENLEMWK LRLRNAGYQQ LRMPSTAYNT ASLLLNLYSG QGYRVEDNCG  660
CITLCWDGKP LLTASAWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-532986784375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001754090.11e-146GAI1-like E3 ubiquitin ligase protein
TrEMBLA7U4T71e-146A7U4T7_PHYPA; DELLA protein
STRINGPP1S12_244V6.11e-144(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-120RGA-like 2