PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0001s0192.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family Dof
Protein Properties Length: 685aa    MW: 68842.7 Da    PI: 7.1677
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0001s0192.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.31.4e-37164223261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          +e+a++cprC+s +tkfCyynny+++qPr+fCk C+ryWt+GG+lrnvPvG+grrknk+ 
  Mapoly0001s0192.1.p 164 PENAVACPRCHSFETKFCYYNNYNVNQPRHFCKHCQRYWTAGGTLRNVPVGAGRRKNKHG 223
                          67899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-26162221IPR003851Zinc finger, Dof-type
PfamPF027013.8E-31166222IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.053168222IPR003851Zinc finger, Dof-type
PROSITE patternPS013610170206IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MMDSPIKLFG KTIAKAAASA FTTSSGEADD AEAVPTTSSG GWVDLPSSSQ DVKENGAESS  60
RLGEINGGGV TFTRQEVKRG SSPDRTSSAC NSAEEEKLCA SPRGGGGATG GAGAELTPSA  120
SGGEAGAGDD EGSEEEDGSG MNGRSKKDGG DDGGKGGEKM PRRPENAVAC PRCHSFETKF  180
CYYNNYNVNQ PRHFCKHCQR YWTAGGTLRN VPVGAGRRKN KHGSTIAPRG QTPEVGTVRS  240
DAPDIASPLI ASKGGVGPVP VQVAVVQAAG SKGGIVRMAV PAASGDPSVL PFLRMQPSPM  300
DTASIFMASS DAGTSSDTVT VACKRGRLAT PGFSDASTGA NDMEQQQQQQ QQPSWGQQSS  360
TNDESACSPL TGIRSGGAQQ QQQQQQQQQQ QQQQQQHPAT NNGMAGPGGC WSAAGPQSSV  420
PPPGAAGAPY GFYNGGWPYG YNVGWSGPPA FCAGGVATAG TGMPGPPPPG NIAAWNGAGG  480
SVWTGVPWPM PGLAWGPPWA MAPWAMSAGH GGASMGSITQ TISMSSGAAA GMVTVPVPCS  540
TTASGGGPAS AAPPSSPSSS LGKHSRGGPP VGAPASSAAA AAACNGAGGA GGGGGGGGGG  600
RMEGGLWAPK SLRMADPEEA MRSSVWRILG VGSRADMTTA STFKAFQPRN ESKKISDDDQ  660
QAVQASLHAN PAAMSRSMNF HESN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2R6XVL70.0A0A2R6XVL7_MARPO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.12e-31Dof family protein