PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0001s0028.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family NF-YC
Protein Properties Length: 291aa    MW: 32555.1 Da    PI: 4.599
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0001s0028.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC56.56.4e-186861898
                NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                         ++++P arikki++ade+v +i+  +Pvl+ska elf+ +l  +++  +     +t+    ++++v++ ++fdfl +iv +
  Mapoly0001s0028.1.p  6 DTRFPAARIKKIMQADEEVGKIAMATPVLISKALELFLQNLCDKTYEITLRRGAKTMSALHLKQCVQQNTVFDFLEEIVAK 86
                         5789************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-26272IPR009072Histone-fold
SuperFamilySSF471132.92E-20388IPR009072Histone-fold
PfamPF008083.2E-18871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MKKKLDTRFP AARIKKIMQA DEEVGKIAMA TPVLISKALE LFLQNLCDKT YEITLRRGAK  60
TMSALHLKQC VQQNTVFDFL EEIVAKVPDI GTDINSEERN GGRRRKVSDG DNDDSEEEDV  120
VKRPKAEIQP TTPGRGRGRG RGRGRGRNGT RVHVEKFEES ETDLSPPPPL ERSAERVTLE  180
TIAVRAKEED APTLEPVASS ATGRPQIRFE FDLNLDLDEN GDVATVAHHK EVKEEEEEQE  240
SESEQQKPPP SWPPTLSVDI PQLGVGHLQD RHTTMHPDED DYDCEDDEDG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A5e-24272575Transcription Regulator NC2 alpha chain
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136145RGRGRGRGRG
2136146RGRGRGRGRGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024369582.11e-82dr1-associated corepressor-like isoform X2
TrEMBLA0A176VEK20.0A0A176VEK2_MARPO; Uncharacterized protein
TrEMBLA0A2R6XV130.0A0A2R6XV13_MARPO; Uncharacterized protein
STRINGPP1S112_139V6.16e-81(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21791635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.13e-49nuclear factor Y, subunit C11