PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010113396.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family GATA
Protein Properties Length: 393aa    MW: 43071.7 Da    PI: 6.239
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010113396.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.61.7e-18309343135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  XP_010113396.1 309 CSHCGVQKTPQWRTGPLGAKTLCNACGVRFKSGRL 343
                     *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577163.99E-14302364No hitNo description
SMARTSM004012.4E-16303357IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.807303339IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.9E-14307341IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.03E-14308356No hitNo description
PfamPF003202.4E-16309343IPR000679Zinc finger, GATA-type
PROSITE patternPS003440309334IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MLYRTHHPFF FHFHPFTRSS SSFPSSSSSY SSSSPSSSKP STTPSPLSTQ VETEMECVEA  60
ALKTSFRKEM GVRQSPHVVF DDLLDVNVQN VVDFSVDDLL NFSDDDGFVV VEEQDQDGDK  120
DLSSPSQEQN QPAEEEAIND NNNPSTSLFV SSVPTTELTL PAEELENLEW LSHFVEESFS  180
EFSTSYLAGV SAEKPPEDET FLPEPKRFAP EKPCFTTPIP AKARSKRPRT GGRVWSLGSP  240
SFIESSSSST TSSSSSSSPT SPWLIYATHS HEPACSVQKP APKKAKKRQA VESFGSGSGP  300
ASAQPPRRCS HCGVQKTPQW RTGPLGAKTL CNACGVRFKS GRLLPEYRPA CSPTFSSDLH  360
SNHHRKVLEM RRKKESVTLP PESVLGPSVV SSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010113396.10.0GATA transcription factor 5
SwissprotQ9FH576e-80GATA5_ARATH; GATA transcription factor 5
TrEMBLW9SCV30.0W9SCV3_9R
STRINGVIT_04s0023g02880.t013e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.23e-52GATA transcription factor 5