PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010111934.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family WOX
Protein Properties Length: 440aa    MW: 48052.7 Da    PI: 8.3204
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010111934.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.59.3e-1855115257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  XP_010111934.1  55 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 115
                     89*****************99*************************************995 PP

2Wus_type_Homeobox111.93.4e-3654116264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
     XP_010111934.1  54 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 116
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.51151116IPR001356Homeobox domain
SuperFamilySSF466895.99E-1251119IPR009057Homeodomain-like
SMARTSM003896.8E-953120IPR001356Homeobox domain
CDDcd000869.45E-954116No hitNo description
Gene3DG3DSA:1.10.10.601.0E-654115IPR009057Homeodomain-like
PfamPF000462.5E-1555115IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MASSNRHWPS LFKSKPCNSH HQWQHDINQS LISNGCHRAP YTSVTGCEER SPEPKPRWNP  60
KPEQIRILEA IFNSGMVNPP RDEIRKIRAQ LQEYGQVGDA NVFYWFQNRK SRSKHKLRHL  120
QNSKQQQQQQ NIHQILPNNS NNITTINTTT TTTTTIAPSS SSSSSSEKSS PKAPNRPAFS  180
MGFSEALNSP TASVNQSTFF QTNSSTHDQF LAEPFLFQSS SSQGFCFPEL MPNGVHNFVP  240
LDHYTQQHNN IGPCTSLLLS EIMNHHGASK KLIGHDHNIN AQEAGNKLQQ NYAPAAVVAA  300
STSPAITALT TAANSTTTRS VTSGNQIQGL ARSDVWMDVC MALVLAIATS TLLLIDKLLI  360
SSAVGEQGSV SGVGPAVGCG KTTVFINDVA FEVPAGPFSV REAFGVEAVL IHSNGQPVLT  420
NEWGVTLHSL HHGAFYYLVS
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010111934.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024031505.10.0WUSCHEL-related homeobox 9 isoform X1
TrEMBLW9SXP00.0W9SXP0_9ROSA; WUSCHEL-related homeobox 9
STRINGXP_010111934.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.18e-63homeobox-3