PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010111372.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HD-ZIP
Protein Properties Length: 372aa    MW: 41517.3 Da    PI: 6.7018
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010111372.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.41e-17219273256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  XP_010111372.1 219 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 273
                     778899***********************************************98 PP

2HD-ZIP_I/II127.26.9e-41219309192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  XP_010111372.1 219 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-ALK 309
                     69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046183.3E-753167IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.605.8E-17203269IPR009057Homeodomain-like
SuperFamilySSF466893.94E-18210276IPR009057Homeodomain-like
PROSITE profilePS5007117.216215275IPR001356Homeobox domain
SMARTSM003897.7E-16217279IPR001356Homeobox domain
CDDcd000862.82E-15219276No hitNo description
PfamPF000463.3E-15219273IPR001356Homeobox domain
PROSITE patternPS000270250273IPR017970Homeobox, conserved site
PfamPF021837.8E-11275309IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.5E-26275318IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MELGLSLGEA PTPFSFLDHK TQKNNMVNNK KDQLGFCMAL GNAFRSDQEK RDQVEDHDHD  60
YDHHDDDGDE HEIIRRSRRV SAADPGVPIQ LDLLPSVPVP RSHMITSSQF RFPWLSDNLV  120
LSEPGSLDGL GKGFDVNRLP AAGAAAATEE TEEGVTISSP NSTLTSFHVD FCVRNSSTGS  180
GRDNINNHNN NKRDHINIEL DTERASSRAS DDEENGSTRK KLRLSKEQSA FLEESFKEHS  240
TLNPKQKLAL AKQLNLRPRQ VEVWFQNRRA RTKLKQTEVD CEYLKRCCET LTEENRRLQK  300
ELQELRALKT SQPFYMQLPA TTLTMCPSCE RVATANPAIS AATATNSTAT LPLAKPIIHP  360
FSHAQAGKAS AS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1217223TRKKLRL
2267275RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010111372.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010111372.10.0homeobox-leucine zipper protein HOX11
SwissprotP466651e-97HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLW9S7S20.0W9S7S2_9ROSA; Homeobox-leucine zipper protein HAT14
STRINGXP_010111372.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-74homeobox from Arabidopsis thaliana