PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010111154.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family VOZ
Protein Properties Length: 485aa    MW: 53913.7 Da    PI: 5.8606
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010111154.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ444.51.2e-1362074231217
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaael 95 
                     pppsaflgpkcalwdc+rpaqg +w+qdycssfha+lalneg+pg+ pvlrp gi+lkdgllfaalsak+qgk+vg+pecegaatakspwna+el
  XP_010111154.1 207 PPPSAFLGPKCALWDCPRPAQGLDWCQDYCSSFHAALALNEGPPGMGPVLRPCGIGLKDGLLFAALSAKAQGKDVGVPECEGAATAKSPWNAPEL 301
                     89********************************************************************************************* PP

             VOZ  96 fdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklv 190
                     fdls+legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp+++ ewhlyeyein++da+alyrlelklv
  XP_010111154.1 302 FDLSVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHIEWHLYEYEINKCDACALYRLELKLV 396
                     *********************************************************************************************** PP

             VOZ 191 dekksakgkvskdsladlqkklgrlta 217
                     d+kksakgk+s+ds+adlqk++grl+a
  XP_010111154.1 397 DGKKSAKGKISNDSVADLQKQMGRLSA 423
                     *************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MEKNSKSKCK SVTHKLFKDK AKNRVDDLQA VFMDLQYARK ESRTIDLAVL EEQVHQMLRE  60
WKAELNEPSP ASSLQQGGSP GSFSSDIYRL LQLCEEEDDA TSPLAAPKPE PTDQSFQVGE  120
TMVFPEGFGM NQVQQEPGFP LIDCKNSSSR VCNVSVNNLE GATHLDYHPY ELHQDFDRNF  180
YTGFNGTGLS VEDALPHISS YLPSICPPPS AFLGPKCALW DCPRPAQGLD WCQDYCSSFH  240
AALALNEGPP GMGPVLRPCG IGLKDGLLFA ALSAKAQGKD VGVPECEGAA TAKSPWNAPE  300
LFDLSVLEGE TIREWLFFDK PRRAFESGNR KQRSLPDYSG RGWHESRKQV MNEFGGLKRS  360
YYMDPQPLNH IEWHLYEYEI NKCDACALYR LELKLVDGKK SAKGKISNDS VADLQKQMGR  420
LSAEFPSPDI KRSVKGRAKI NTKVNAGGNV YTTASRVATT NGTFGYGLGA PYDYLVENVT  480
EYYLT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010111154.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010111154.10.0transcription factor VOZ1 isoform X1
RefseqXP_024031048.10.0transcription factor VOZ1 isoform X1
RefseqXP_024031049.10.0transcription factor VOZ1 isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLW9SVP90.0W9SVP9_9ROSA; Uncharacterized protein
STRINGXP_010111154.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]