PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010110935.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 252aa    MW: 28885.2 Da    PI: 9.8105
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010110935.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM110.81.5e-34161441128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lp G+rF+Ptdeelvv+yLk+kv + +l++  vi+++d+++++Pw+Lp +v   +++ yfF+k+++  +  ++k+  + sgyWk  gk++ ++++
  XP_010110935.1  16 LPIGYRFRPTDEELVVHYLKRKVFSIPLPA-LVIPDFDVFQTDPWTLPGEV---KEKRYFFHKQKRDVNIMSKKRVNAGSGYWKPIGKERLIVAS 106
                     699*************************99.78***************554...4578****99998766555555899**************99 PP

             NAM  96 ..kgelvglkktLvfykgrapkge...ktdWvmheyrl 128
                       +++ vg++kt+vf  g++p+ +   + +W+mhe++l
  XP_010110935.1 107 elNNQPVGIRKTMVFCGGNRPDNHhhhNHRWLMHEFHL 144
                     889999**********77655543223899******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-4110174IPR003441NAC domain
PROSITE profilePS5100539.29316174IPR003441NAC domain
PfamPF023651.8E-2117144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MEEKQKLLMS SGGLKLPIGY RFRPTDEELV VHYLKRKVFS IPLPALVIPD FDVFQTDPWT  60
LPGEVKEKRY FFHKQKRDVN IMSKKRVNAG SGYWKPIGKE RLIVASELNN QPVGIRKTMV  120
FCGGNRPDNH HHHNHRWLMH EFHLVRPGPT PNSVHLISSM ELKECWVVCG VFQKKRRPKK  180
KNGTNSERKH IMMTEVTRPK CSVGPPTPSL SSCSGITEVS TLINGAIDYD YDDDQEESSS  240
KINISHSDDN KP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-271418015171NO APICAL MERISTEM PROTEIN
1ut4_B6e-271418015171NO APICAL MERISTEM PROTEIN
1ut7_A6e-271418015171NO APICAL MERISTEM PROTEIN
1ut7_B6e-271418015171NO APICAL MERISTEM PROTEIN
3swm_A6e-271418018174NAC domain-containing protein 19
3swm_B6e-271418018174NAC domain-containing protein 19
3swm_C6e-271418018174NAC domain-containing protein 19
3swm_D6e-271418018174NAC domain-containing protein 19
3swp_A6e-271418018174NAC domain-containing protein 19
3swp_B6e-271418018174NAC domain-containing protein 19
3swp_C6e-271418018174NAC domain-containing protein 19
3swp_D6e-271418018174NAC domain-containing protein 19
4dul_A6e-271418015171NAC domain-containing protein 19
4dul_B6e-271418015171NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172179QKKRRPKK
2173178KKRRPK
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010110935.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010110935.10.0NAC domain-containing protein 83
TrEMBLW9S6J50.0W9S6J5_9ROSA; NAC domain-containing protein 68
STRINGXP_010110935.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.12e-41NAC domain containing protein 83