PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010109771.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family GATA
Protein Properties Length: 310aa    MW: 34243.3 Da    PI: 4.757
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010109771.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA581.2e-18229262134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     Cs+C++ kTp+WR gp g ktLCnaCG+++++ +
  XP_010109771.1 229 CSHCQVQKTPQWRAGPLGAKTLCNACGVRFKSGR 262
                     *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.8E-814305IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.121223259IPR000679Zinc finger, GATA-type
SMARTSM004013.7E-13223273IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.38E-13225286No hitNo description
Gene3DG3DSA:3.30.50.101.7E-14227260IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.71E-13228270No hitNo description
PfamPF003201.9E-16229262IPR000679Zinc finger, GATA-type
PROSITE patternPS003440229254IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MECMEAKALK PSLLGELTQP EFIEEFRYAS TNTTGVSCVP GEDFSVDELL NLQNVEFEEG  60
FVEEEEDDEE EEEEEKDSLS IDGENSNVSV AGDSESPLTS ALAVPDDDIA ELEWVSHFVD  120
DSVSDFSLLH PLGKQRTEAN WYEPEPRPTG KTPLCFPSVP VRPRTKRARP TTRPSPLSQL  180
SESSSSSMSN LIFVLSKAIR EPARKKQKIK PAAVQPGSGS TGSQFQRRCS HCQVQKTPQW  240
RAGPLGAKTL CNACGVRFKS GRLFPEYRPA CSPTFCSDVH SNSHRKVLEM RKKKEIVGPG  300
SGLTEVISSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010109771.10.0hypothetical protein L484_008447
TrEMBLW9S3D00.0W9S3D0_9R
STRINGPOPTR_0009s12620.18e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-40GATA transcription factor 5