PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010109438.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HD-ZIP
Protein Properties Length: 289aa    MW: 32361.3 Da    PI: 7.2841
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010109438.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.55.6e-19142196256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tk+q   Le+ F+++ +++ +++++LAk+l+L  rqV vWFqNrRa+ k
  XP_010109438.1 142 RKKLRLTKQQSALLEDSFKEHTTLNPKQKQDLAKQLNLRPRQVEVWFQNRRARTK 196
                     78889************************************************98 PP

2HD-ZIP_I/II120.49.6e-39142230190
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                     +kk+rl+k+q++lLE+sF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E +ye+Lk+++++l+een+rL+ke +eL+ +
  XP_010109438.1 142 RKKLRLTKQQSALLEDSFKEHTTLNPKQKQDLAKQLNLRPRQVEVWFQNRRARTKLKQTEAEYEQLKKCCETLTEENKRLQKELQELK-S 230
                     69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.08E-18135199IPR009057Homeodomain-like
PROSITE profilePS5007117.443138198IPR001356Homeobox domain
SMARTSM003899.4E-17140202IPR001356Homeobox domain
CDDcd000869.28E-17141199No hitNo description
Gene3DG3DSA:1.10.10.601.1E-17142196IPR009057Homeodomain-like
PfamPF000462.2E-16142196IPR001356Homeobox domain
PROSITE patternPS000270173196IPR017970Homeobox, conserved site
PfamPF021832.0E-7198231IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.6E-19198241IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGSDHGVCNT GLGLGLDSFH HKADHDHEDK AASLMNKSSG LQYHESKKKL CLRYDHLLPS  60
DLTLAPSDEG YHLQPADQNT SNSELINIRR ASSDLTSFSN SSTTVKRDRD IISGEEVEIE  120
RVVCSRVSTT NDQEDELEGS PRKKLRLTKQ QSALLEDSFK EHTTLNPKQK QDLAKQLNLR  180
PRQVEVWFQN RRARTKLKQT EAEYEQLKKC CETLTEENKR LQKELQELKS LKLAAPFFMQ  240
FPTSTTLTIC PSCERICGGD GGASSASSLL IGPKSHFSNP FTTHPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1190198RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010109438.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010109438.10.0homeobox-leucine zipper protein HAT22
SwissprotP466042e-74HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLW9SRI20.0W9SRI2_9ROSA; Homeobox-leucine zipper protein HAT22
STRINGXP_010109438.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-59HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]