PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010108964.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HD-ZIP
Protein Properties Length: 326aa    MW: 36766.7 Da    PI: 7.0551
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010108964.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.2e-18100152456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + +++ eq+++Le+ Fe+ +++  e++ +LAk+lgL+ rqV +WFqNrRa++k
  XP_010108964.1 100 KKRLNLEQVKTLEKSFEMGNKLEPERKLHLAKSLGLQPRQVAIWFQNRRARWK 152
                     4568889*********************************************9 PP

2HD-ZIP_I/II129.61.2e-4198190193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekk+rl+ eqvk+LE+sFe+ +kLeperK +la++Lglqprqva+WFqnrRAR+ktkqlEkdy++Lk+++d lk++n++L++++++L+++l++
  XP_010108964.1  98 EKKKRLNLEQVKTLEKSFEMGNKLEPERKLHLAKSLGLQPRQVAIWFQNRRARWKTKQLEKDYDVLKKQFDLLKADNDALHSQNKKLHAQLSA 190
                     69***************************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.71494154IPR001356Homeobox domain
SuperFamilySSF466894.71E-1996156IPR009057Homeodomain-like
SMARTSM003895.4E-1897158IPR001356Homeobox domain
CDDcd000861.90E-1699155No hitNo description
PfamPF000461.2E-15100152IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.2E-19102162IPR009057Homeodomain-like
PRINTSPR000312.3E-5125134IPR000047Helix-turn-helix motif
PROSITE patternPS000270129152IPR017970Homeobox, conserved site
PRINTSPR000312.3E-5134150IPR000047Helix-turn-helix motif
PfamPF021838.8E-15154193IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MAFPPHSFMF QAHQEDHDPH QDHPHHQQHF LGGGGHHAPP FMLLKRSVSF SGVDDHGHHD  60
HHHHHHNMRC EELLMQGGGG GGEDEALSDD GSQSIGGEKK KRLNLEQVKT LEKSFEMGNK  120
LEPERKLHLA KSLGLQPRQV AIWFQNRRAR WKTKQLEKDY DVLKKQFDLL KADNDALHSQ  180
NKKLHAQLSA LKGGSTRDLN EGGRENHKKE GEGSWSNNGS ENSSDVNLEI SRTTTITQVI  240
NTCSSASSQI LNGKTLFPST LRPTSITQLL VQGSPRSEHH PPHQMVQSSD NENLCNMFVN  300
GGVNVNAVEQ DHQQGFWPWP EQPYFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146154RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00322DAPTransfer from AT3G01220Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010108964.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108964.10.0homeobox-leucine zipper protein ATHB-20
TrEMBLW9S1560.0W9S156_9ROSA; Homeobox-leucine zipper protein ATHB-20
STRINGXP_010108964.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-65homeobox 3