PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010108694.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 294aa    MW: 33792.1 Da    PI: 8.5378
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010108694.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.38.6e-55101351128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+v+yLk++++++++++ ++i+evdiyk++Pw+Lp k++ +ekewyfFs+rd+ky++g r+nrat sgyWkatg+dk+++s 
  XP_010108694.1  10 LPPGFRFHPTDEELIVYYLKNQATSRPCPV-SIIPEVDIYKFDPWELPDKAEFGEKEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIYS- 102
                     79****************************.89***************99999*****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +++ vg+kk Lvfykg+ pkg ktdW+mheyrl
  XP_010108694.1 103 GSKYVGVKKALVFYKGKPPKGIKTDWIMHEYRL 135
                     999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-668163IPR003441NAC domain
PROSITE profilePS5100561.78110163IPR003441NAC domain
PfamPF023653.9E-2711135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MEGKANSGVL PPGFRFHPTD EELIVYYLKN QATSRPCPVS IIPEVDIYKF DPWELPDKAE  60
FGEKEWYFFS PRDRKYPNGV RPNRATVSGY WKATGTDKAI YSGSKYVGVK KALVFYKGKP  120
PKGIKTDWIM HEYRLTDSRR QIPTKQLGSM RLDDWVLCRI YKKRHMAKAL EPKVEDSSPH  180
TDITAHVGHE ANEEQMLKFP RTYSLAHLLE LDYLGPIPQL LNDNNPYNSA HDFNVNSNTW  240
PNSGTGFVQN LQFGEMPYQN SDLGKFQVAQ AQSSNFNQQH VFGNQGYDVY GLER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-721016817170NO APICAL MERISTEM PROTEIN
1ut4_B5e-721016817170NO APICAL MERISTEM PROTEIN
1ut7_A5e-721016817170NO APICAL MERISTEM PROTEIN
1ut7_B5e-721016817170NO APICAL MERISTEM PROTEIN
4dul_A5e-721016817170NAC domain-containing protein 19
4dul_B5e-721016817170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010108694.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108694.10.0NAC transcription factor 29 isoform X1
SwissprotK4BNG71e-126NAP2_SOLLC; NAC domain-containing protein 2
TrEMBLW9S8C60.0W9S8C6_9ROSA; NAC domain-containing protein 29
STRINGXP_010108694.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41033262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-112NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]