PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010108419.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family TCP
Protein Properties Length: 360aa    MW: 41354.9 Da    PI: 5.4611
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010108419.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP107.62e-33135215383
             TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                     +kk rh k++T++g+RdRRvRlsa++a++f+d+qd+LG+d++ k+i+WL+++ak+ai +l++++++++ ++++ + + + +
  XP_010108419.1 135 KKKERHNKVCTSKGPRDRRVRLSAHTAIQFYDVQDRLGYDQPTKAIDWLIEKAKAAIEALAELPAQNNDSFDTTDCVTQPQ 215
                     69*************************************************************666663332222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.4E-30135219IPR005333Transcription factor, TCP
PROSITE profilePS5136929.626136194IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MMSYYLLDSV PHQILQQREL KDDEKEEKAR GQDRDQAEEE DEEGEQGQGQ QMIFGKYQHV  60
QLPLCDKRYD IDYEKSCRKL CYSKQLALEK HRIVKFERGE RRKQASARPS SKPTQENEAG  120
DALQVHGGHV VRFIKKKERH NKVCTSKGPR DRRVRLSAHT AIQFYDVQDR LGYDQPTKAI  180
DWLIEKAKAA IEALAELPAQ NNDSFDTTDC VTQPQSIMRD KNLYPLQYHQ GCDNWPQKIS  240
LGSTSKCDKE EQLHLNNEGI FSMVSQFQDY PTEQNSTQGL CLSLQSSEDQ DLYLHHSSPI  300
DFDEQALNSM SSLTDSTSID TGRFQSLMAI NSSAGNEGAQ FFFNSLPSLL QQPFLRENQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-17141194154Putative transcription factor PCF6
5zkt_B2e-17141194154Putative transcription factor PCF6
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010108419.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108419.10.0transcription factor TCP4
RefseqXP_024029269.10.0transcription factor TCP4
TrEMBLW9RZN40.0W9RZN4_9ROSA; Uncharacterized protein
STRINGXP_010108419.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF148631014
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15030.32e-29TCP family protein